Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged T is approximately 0.03ng/ml as a capture antibody.)

Mouse T Monoclonal Antibody | anti-TBXT antibody

T (T, Brachyury Homolog (mouse), MGC104817, TFT) (AP)

Gene Names
TBXT; T; TFT; SAVA
Applications
Western Blot
Purity
Purified
Synonyms
T; Monoclonal Antibody; T (T; Brachyury Homolog (mouse); MGC104817; TFT) (AP); TFT; anti-TBXT antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
5C6
Specificity
Recognizes T.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-TBXT antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
T (NP_003172, 222aa-320aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ERSDHKEMMEEPGDSQQPGYSQWGWLLPGTSTLCPPANPHPQFGGALSLPSTHSCDRYPTLRSHRSSPYPSPYAHRNNSPTYSDNSPACLSMLQSHDNW
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged T is approximately 0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged T is approximately 0.03ng/ml as a capture antibody.)
Related Product Information for anti-TBXT antibody
The protein encoded by this gene is an embryonic nuclear transcription factor that binds to a specific DNA element, the palindromic T-site. It binds through a region in its N-terminus, called the T-box, and effects transcription of genes required for mesoderm formation and differentiation. The protein is localized to notochord-derived cells. [provided by RefSeq]
Product Categories/Family for anti-TBXT antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47kDa
NCBI Official Full Name
T-box transcription factor T isoform 1
NCBI Official Synonym Full Names
T-box transcription factor T
NCBI Official Symbol
TBXT
NCBI Official Synonym Symbols
T; TFT; SAVA
NCBI Protein Information
T-box transcription factor T; brachyury protein
UniProt Protein Name
Brachyury protein
Protein Family
UniProt Gene Name
T
UniProt Entry Name
BRAC_HUMAN

NCBI Description

The protein encoded by this gene is an embryonic nuclear transcription factor that binds to a specific DNA element, the palindromic T-site. It binds through a region in its N-terminus, called the T-box, and effects transcription of genes required for mesoderm formation and differentiation. The protein is localized to notochord-derived cells. Variation in this gene was associated with susceptibility to neural tube defects and chordoma. A mutation in this gene was found in a family with sacral agenesis with vertebral anomalies. [provided by RefSeq, Sep 2018]

Uniprot Description

Brachyury: Involved in the transcriptional regulation of genes required for mesoderm formation and differentiation. Binds to a palindromic site (called T site) and activates gene transcription when bound to such a site. Genetic variations in T are associated with susceptibility to neural tube defects (NTD). NTD are common congenital malformations. Spina bifida, which results from malformations in the caudal region of the neural tube, is compatible with life but associated with significant morbidity, including lower limb paralysis. T is involved in susceptibility to the development of chordoma (CHDM). Chordomas are rare, clinically malignant tumors derived from notochordal remnants. They occur along the length of the spinal axis, predominantly in the sphenooccipital, vertebral and sacrococcygeal regions. They are characterized by slow growth, local destruction of bone, extension into adjacent soft tissues and rarely, distant metastatic spread. Susceptibility to development of chordomas is due to a T gene duplication.

Protein type: Motility/polarity/chemotaxis; DNA-binding; Cell cycle regulation; Transcription factor

Chromosomal Location of Human Ortholog: 6q27

Cellular Component: cytoplasm; nuclear chromatin; nucleus

Molecular Function: RNA polymerase II transcription factor activity, enhancer binding; transcription factor activity

Biological Process: transcription from RNA polymerase II promoter; heart morphogenesis; somitogenesis; neural plate morphogenesis; embryonic skeletal development; mesoderm migration; notochord formation; negative regulation of transcription from RNA polymerase II promoter; Wnt receptor signaling pathway through beta-catenin; signal transduction; BMP signaling pathway; determination of anterior/posterior axis, embryo; positive regulation of cell proliferation; neural tube closure; penetration of zona pellucida; mesoderm development; vasculogenesis

Disease: Neural Tube Defects; Sacral Agenesis With Vertebral Anomalies

Research Articles on TBXT

Similar Products

Product Notes

The TBXT t (Catalog #AAA6162083) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's T can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TBXT t for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "T, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.