Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human SYT4 Monoclonal Antibody | anti-SYT4 antibody

SYT4 (KIAA1342, Synaptotagmin-4, Synaptotagmin IV, SytIV) (MaxLight 490)

Gene Names
SYT4; HsT1192
Reactivity
Human
Applications
Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SYT4; Monoclonal Antibody; SYT4 (KIAA1342; Synaptotagmin-4; Synaptotagmin IV; SytIV) (MaxLight 490); anti-SYT4 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG3,k
Clone Number
5F8
Specificity
Recognizes human SYT4.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.
Applicable Applications for anti-SYT4 antibody
FLISA, Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-100 from human SYT4 (NP_065834) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAPITTSREEFDEIPTVVGIFSAFGLVFTVSLFAWICCQRKSSKSNKTPPYKFVHVLKGVDIYPENLNSKKKFGADDKNEVKNKPAVPKNSLHLDLEKR
Conjugate
MaxLight490
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Product Categories/Family for anti-SYT4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46.1 kDa (409aa) confirmed by MALDI-TOF
NCBI Official Full Name
synaptotagmin-4
NCBI Official Synonym Full Names
synaptotagmin 4
NCBI Official Symbol
SYT4
NCBI Official Synonym Symbols
HsT1192
NCBI Protein Information
synaptotagmin-4
UniProt Protein Name
Synaptotagmin-4
Protein Family
UniProt Gene Name
SYT4
UniProt Synonym Gene Names
KIAA1342; SytIV
UniProt Entry Name
SYT4_HUMAN

Uniprot Description

SYT4: May be involved in Ca(2+)-dependent exocytosis of secretory vesicles through Ca(2+) and phospholipid binding to the C2 domain or may serve as Ca(2+) sensors in the process of vesicular trafficking and exocytosis. Belongs to the synaptotagmin family.

Protein type: Vesicle; Calcium-binding; Membrane protein, integral

Chromosomal Location of Human Ortholog: 18q12.3

Cellular Component: neuron projection; synaptic vesicle membrane; intracellular membrane-bound organelle; perinuclear region of cytoplasm; integral to membrane; plasma membrane; cell junction

Molecular Function: clathrin binding; SNARE binding; phosphatidylserine binding; transporter activity; calcium ion binding

Biological Process: negative regulation of vesicle fusion; exocytosis; negative regulation of calcium ion-dependent exocytosis; neurotransmitter secretion

Research Articles on SYT4

Similar Products

Product Notes

The SYT4 syt4 (Catalog #AAA6203634) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SYT4 (KIAA1342, Synaptotagmin-4, Synaptotagmin IV, SytIV) (MaxLight 490) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SYT4 can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunofluorescence (IF), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SYT4 syt4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SYT4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.