Mouse anti-Human SYP Monoclonal Antibody | anti-SYP antibody

SYP (Synaptophysin, Major Synaptic Vesicle Protein p38) (FITC)

Cat. Num. AAA6150001

• Gene Names: SYP; MRX96; MRXSYP
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: SYP; Monoclonal Antibody; SYP (Synaptophysin; Major Synaptic Vesicle Protein p38) (FITC); anti-SYP antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 3B3
• Specificity: Recognizes human SYP.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-SYP antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-314 from human SYP (AAH64550) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MLLLADMDVVNQLVAGGQFRVVKEPLGFVKVLQWVFAIFAFATCGSYSGELQLNVDCANKTESDLSIEVEFEYPFRLHQVYFDAPTCRGGTTKVFLVGDYSSSAEFFVTVAVFAFLYSMGALATYIFLQNKYRENNKGPMLDFLATAVFAFMWLVSSSAWAKGLSDVKMATDPENIIKEMPVCRQTGNTCKELRDLVTSGLNTSVVFGFLNLVLWVGNLWFVFKETGWAAPFLRAPPGAPEKQPAPGDAYGDAGYGQGPGGYGPQDSYGPQGGYQPDYGQPAGSGGSGYGPQGDYGQQGYGPQGAPTSFSNQM
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged SYP is ~1ng/ml as a capture antibody.)

Related Product Information for anti-SYP antibody

Synaptophysin (p38) is an abundant integral membrane protein of small synaptic vesicles in the brain. It is also present in endocrine cells, where it is associated with small electron-translucent vesicles. Synaptophysin expression has been widely used as a marker for synaptogenesis in developmental studies in vivo and in vitro and as a marker for neuron-specific cell lineages in tumors of the central nervous system and of peripheral neuroendocrine cell derivation. It has multiple transmembrane regions and a cytoplasmic tail that contains 10 copies of a tyrosine-rich repeat. Biochemical experiments have demonstrated that it transverses the membrane four times and has cytoplasmic carboxyl- and amino-termini. It also contain unstable intramolecular disulfide bonds that spontaneously rearrange, thereby creating higher-order polymers that are larger than the native protein and that have distinctly different biochemical properties. Mutations involving the synaptophysin gene may be responsible for an X-linked disorder. Chromosomal localization of the human gene for synaptophysin established the human SYP locus on the X chromosome in subbands Xpll.22-pll.23. It is involved in structural functions as organizing other membrane components or in targeting the vesicles to the plasma membrane.

Product Categories/Family for anti-SYP antibody

Antibodies; Synaptophysin

NCBI and Uniprot Product Information

• NCBI GI #: 40555854
• NCBI GeneID: 6855
• Molecular Weight: 20,757 Da
• NCBI Official Full Name: Homo sapiens synaptophysin, mRNA
• NCBI Official Synonym Full Names: synaptophysin
• NCBI Official Symbol: SYP
• NCBI Official Synonym Symbols: MRX96; MRXSYP
• NCBI Protein Information: synaptophysin
• Protein Family: Syphaxin

NCBI Description

This gene encodes an integral membrane protein of small synaptic vesicles in brain and endocrine cells. The protein also binds cholesterol and is thought to direct targeting of vesicle-associated membrane protein 2 (synaptobrevin) to intracellular compartments. Mutations in this gene are associated with X-linked mental retardation (XLMR). [provided by RefSeq, Aug 2011]