Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human Syntaxin 12 Monoclonal Antibody | anti-STX12 antibody

Syntaxin 12 (Syntaxin-12, STX12) (MaxLight 490)

Gene Names
STX12; STX13; STX14
Reactivity
Human
Applications
Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Syntaxin 12; Monoclonal Antibody; Syntaxin 12 (Syntaxin-12; STX12) (MaxLight 490); STX13; STX14; anti-STX12 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3B9
Specificity
Recognizes human STX12.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.
Sequence Length
3034
Applicable Applications for anti-STX12 antibody
FLISA, Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa108-207 from STX12 (NP_803173) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
NDFSAALNNFQAVQRRVSEKEKESIARARAGSRLSAEERQREEQLVSFDSHEEWNQMQSQEDEVAITEQDLELIKERETAIRQLEADILDVNQIFKDLA*
Conjugate
MaxLight490
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-STX12 antibody
MaxLight490 is a new Blue-Green photostable dye conjugate comparable to DyLight488, Alexa Fluor488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000.
Product Categories/Family for anti-STX12 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens syntaxin 12 (STX12), mRNA
NCBI Official Synonym Full Names
syntaxin 12
NCBI Official Symbol
STX12
NCBI Official Synonym Symbols
STX13; STX14
NCBI Protein Information
syntaxin-12
UniProt Protein Name
Syntaxin-12
Protein Family
UniProt Gene Name
STX12
UniProt Entry Name
STX12_HUMAN

Uniprot Description

STX12: SNARE that acts to regulate protein transport between late endosomes and the trans-Golgi network. The SNARE complex containing STX6, STX12, VAMP4 and VTI1A mediates vesicle fusion (in vitro). Belongs to the syntaxin family.

Protein type: Vesicle; Membrane protein, integral

Chromosomal Location of Human Ortholog: 1p35.3

Cellular Component: Golgi membrane; SNARE complex; integral to membrane; endomembrane system; endosome membrane; phagocytic vesicle; lipid raft

Molecular Function: SNAP receptor activity; SNARE binding; protein binding

Biological Process: vesicle fusion; intracellular protein transport; vesicle docking; protein stabilization; cholesterol efflux

Research Articles on STX12

Similar Products

Product Notes

The STX12 stx12 (Catalog #AAA6203589) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Syntaxin 12 (Syntaxin-12, STX12) (MaxLight 490) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Syntaxin 12 can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunoprecipitation (IP), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the STX12 stx12 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Syntaxin 12, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.