Mouse anti-Human Syntaphilin Monoclonal Antibody | anti-SNPH antibody

Syntaphilin (SNPH, bA314N13.5, KIAA0374) (HRP)

Cat. Num. AAA6155107

• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: Syntaphilin; Monoclonal Antibody; Syntaphilin (SNPH; bA314N13.5; KIAA0374) (HRP); anti-SNPH antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3B6
• Specificity: Recognizes human SNPH.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
• Sequence Length: 5016

• Applicable Applications for anti-SNPH antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa251-348 from SNPH (NP_055538) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: TLSRTDALEASSLLSSGVDCGTEETSLHSSFGLGPRFPASNTYEKLLCGMEAGVQASCMQERAIQTDFVQYQPDLDTILEKVTQAQVCGTDPESGDRC
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.52kD).)

Testing Data

(Detection limit for recombinant GST tagged SNPH is 0.3ng/ml as a capture antibody.)

Product Categories/Family for anti-SNPH antibody

Antibodies; Neuroscience

NCBI and Uniprot Product Information

• NCBI GI #: 1676325227
• NCBI GeneID: 9751
• NCBI Accession #: NM_014723.4
• NCBI GenBank Nucleotide #: NM_014723
• UniProt Accession #: O15079
• NCBI Official Full Name: Homo sapiens syntaphilin (SNPH), transcript variant 2, mRNA
• NCBI Official Synonym Full Names: syntaphilin
• NCBI Official Symbol: SNPH
• NCBI Protein Information: syntaphilin
• UniProt Protein Name: Syntaphilin
• Protein Family: Syntaphilin
• UniProt Gene Name: SNPH
• UniProt Synonym Gene Names: KIAA0374
• UniProt Entry Name: SNPH_HUMAN

NCBI Description

Syntaxin-1, synaptobrevin/VAMP, and SNAP25 interact to form the SNARE complex, which is required for synaptic vesicle docking and fusion. The protein encoded by this gene is membrane-associated and inhibits SNARE complex formation by binding free syntaxin-1. Expression of this gene appears to be brain-specific. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Dec 2015]

Uniprot Description

syntaphilin: Inhibits SNARE complex formation by absorbing free syntaxin-1. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Vesicle; Membrane protein, integral

Chromosomal Location of Human Ortholog: 20p13

Cellular Component: presynaptic membrane; neuron projection; cell soma; cytoplasmic microtubule; mitochondrial membrane; cytoplasm; integral to membrane; cell junction

Molecular Function: syntaxin-1 binding

Biological Process: neuron differentiation; neurotransmitter secretion; brain development; synaptic vesicle docking during exocytosis