Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to SVIL on HeLa cell. [antibody concentration 10ug/ml])

Mouse anti-Human SVIL Monoclonal Antibody | anti-SVIL antibody

SVIL (Supervillin, Archvillin, p205/p250, DKFZp686A17191) APC

Reactivity
Human
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SVIL; Monoclonal Antibody; SVIL (Supervillin; Archvillin; p205/p250; DKFZp686A17191) APC; anti-SVIL antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
6E10
Specificity
Recognizes human SVIL.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
1788
Applicable Applications for anti-SVIL antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1679-1787 from human SVIL (NP_003165) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LIHAGLEPLTFTNMFPSWEHREDIAEITEMDTEVSNQITLVEDVLAKLCKTIYPLADLLARPLPEGVDPLKLEIYLTDEDFEFALDMTRDEYNALPAWKQVNLKKAKG
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to SVIL on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to SVIL on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged SVIL is ~3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SVIL is ~3ng/ml as a capture antibody.)
Product Categories/Family for anti-SVIL antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
supervillin isoform 1
NCBI Official Synonym Full Names
supervillin
NCBI Official Symbol
SVIL
NCBI Protein Information
supervillin
UniProt Protein Name
Supervillin
Protein Family
UniProt Gene Name
SVIL
UniProt Entry Name
SVIL_HUMAN

NCBI Description

This gene encodes a bipartite protein with distinct amino- and carboxy-terminal domains. The amino-terminus contains nuclear localization signals and the carboxy-terminus contains numerous consecutive sequences with extensive similarity to proteins in the gelsolin family of actin-binding proteins, which cap, nucleate, and/or sever actin filaments. The gene product is tightly associated with both actin filaments and plasma membranes, suggesting a role as a high-affinity link between the actin cytoskeleton and the membrane. The encoded protein appears to aid in both myosin II assembly during cell spreading and disassembly of focal adhesions. Several transcript variants encoding different isoforms of supervillin have been described. [provided by RefSeq, Apr 2016]

Uniprot Description

supervillin: an actin-binding protein that links filamentous actin to the plasma membrane. Binds filamentous actin and myosin II bind within the rsds 1-830 of the amino terminus, an extended intrinsically disordered region (IDR). Forms a high-affinity link between the actin cytoskeleton and the plasma membrane. Four human isoforms are formed by alternative splicing. Isoform 1 (archvillin) is muscle specific and among the first costameric proteins to assemble during myogenesis and it contributes to myogenic membrane structure and differentiation. Appears to be involved in myosin II assembly. May modulate myosin II regulation through MLCK during cell spreading, an initial step in cell migration. May play a role in invadopodial function. Isoform 2 may be involved in modulation of focal adhesions. Supervillin-mediated down-regulation of focal adhesions involves binding to TRIP6.

Protein type: Motility/polarity/chemotaxis; Nuclear receptor co-regulator; Contractile; Actin-binding

Chromosomal Location of Human Ortholog: 10p11.2

Cellular Component: costamere; focal adhesion; cytoplasm; plasma membrane; podosome; midbody; nucleus; actin cytoskeleton; cleavage furrow

Molecular Function: actin filament binding; protein binding

Biological Process: positive regulation of cytokinesis; skeletal muscle development; cytoskeleton organization and biogenesis

Research Articles on SVIL

Similar Products

Product Notes

The SVIL svil (Catalog #AAA6139384) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SVIL (Supervillin, Archvillin, p205/p250, DKFZp686A17191) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SVIL can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SVIL svil for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SVIL, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.