Mouse anti-Human ACY1 Monoclonal Antibody | anti-ACY1 antibody

ACY1 (Aminoacylase 1, Aminoacylase-1, ACY-1, N-acyl-L-amino-acid Amidohydrolase) (PE)

Cat. Num. AAA6156384

• Gene Names: ACY1; ACY-1; ACY1D; HEL-S-5
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Immunohistochemistry, Immunoprecipitation, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: ACY1; Monoclonal Antibody; ACY1 (Aminoacylase 1; Aminoacylase-1; ACY-1; N-acyl-L-amino-acid Amidohydrolase) (PE); anti-ACY1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 4F1-B7
• Specificity: Recognizes human ACY1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-ACY1 antibody: ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunoprecipitation (IP), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-408 from human ACY1 (AAH00545) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MTSKGPAEEHPSVTLFRQYLRIRTVQPKPDYGAAVAFFEETARQLGLGCQKVEVAPGYVVTVLTWPGTNPTLSSILLNSHTDVVPVFKEHWSHDPFEAFKDSEGYIYARGAQDVKCVSIQYLEAVRRLKVEGHRFPRTIHMTFVPDEEVGGHQGMELFVQRPEFHALRAGFALDEGIANPTDAFTVFYSERSPWWVRVTSTGRPGHASRFMEDTAAEKLHKVVNSILAFREKEWQRLQSNPHLKEGSVTSVNLTKLEGGVAYNVIPATMSASFDFRVAPDVDFKAFEEQLQSWCQAAGEGVTLEFAQKWMHPQVTPTDDSNPWWAAFSRVCKDMNLTLEPEIMPAATDNRYIRAVGVPALGFSPMNRTPVLLHDHDERLHEAVFLRGVDIYTRLLPALASVPALPSDS
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (70.62kD).)

Western Blot (WB)

(ACY1 monoclonal antibody Western Blot analysis of ACY1 expression in K-562.)

Immunoprecipitation (IP)

(Immunoprecipitation of ACY1 transfected lysate using ACY1 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with ACY1 rabbit polyclonal antibody.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to ACY1 on formalin-fixed paraffin-embedded human malignant lymphoma, diffuse large B tissue. [antibody concentration 3ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to ACY1 on HeLa cell. [antibody concentration 10ug/ml].)

Western Blot (WB)

(Western Blot analysis of ACY1 expression in transfected 293T cell line by ACY1 monoclonal antibody. Lane 1: ACY1 transfected lysate (45.9kD). Lane 2: Non-transfected lysate.)

Product Categories/Family for anti-ACY1 antibody

Antibodies; Enzymes

References

1. Profiling of antibody production against xenograft-released proteins by protein microarrays discovers prostate cancer markers. Jansen FH, Rijswijk A, Teubel W, Weerden WM, Reneman S, Bemd GJ, Roobol MJ, Bangma CH, Staal FJ, Jenster G.J Proteome Res. 2011 Dec 2.

NCBI and Uniprot Product Information

• NCBI GI #: 33875558
• NCBI GeneID: 95
• Molecular Weight: 42,195 Da
• NCBI Official Full Name: Homo sapiens aminoacylase 1, mRNA
• NCBI Official Synonym Full Names: aminoacylase 1
• NCBI Official Symbol: ACY1
• NCBI Official Synonym Symbols: ACY-1; ACY1D; HEL-S-5
• NCBI Protein Information: aminoacylase-1
• Protein Family: Aminoacylase

NCBI Description

This gene encodes a cytosolic, homodimeric, zinc-binding enzyme that catalyzes the hydrolysis of acylated L-amino acids to L-amino acids and an acyl group, and has been postulated to function in the catabolism and salvage of acylated amino acids. This gene is located on chromosome 3p21.1, a region reduced to homozygosity in small-cell lung cancer (SCLC), and its expression has been reported to be reduced or undetectable in SCLC cell lines and tumors. The amino acid sequence of human aminoacylase-1 is highly homologous to the porcine counterpart, and this enzyme is the first member of a new family of zinc-binding enzymes. Mutations in this gene cause aminoacylase-1 deficiency, a metabolic disorder characterized by central nervous system defects and increased urinary excretion of N-acetylated amino acids. Alternative splicing of this gene results in multiple transcript variants. Read-through transcription also exists between this gene and the upstream ABHD14A (abhydrolase domain containing 14A) gene, as represented in GeneID:100526760. A related pseudogene has been identified on chromosome 18. [provided by RefSeq, Nov 2010]