Mouse anti-Human Survivin Monoclonal Antibody | anti-BIRC5 antibody

Survivin (Apoptosis Inhibitor 4, API4, Apoptosis Inhibitor Survivin, Baculoviral IAP Repeat Containing Protein 5, BIRC5, EPR-1, IAP4) (HRP)

Cat. Num. AAA6155289

• Gene Names: BIRC5; API4; EPR-1
• Reactivity: Human
• Applications: ELISA, Immunoprecipitation, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: Survivin; Monoclonal Antibody; Survivin (Apoptosis Inhibitor 4; API4; Apoptosis Inhibitor Survivin; Baculoviral IAP Repeat Containing Protein 5; BIRC5; EPR-1; IAP4) (HRP); anti-BIRC5 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 5B10
• Specificity: Recognizes human BIRC5.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-BIRC5 antibody: ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1-100 from human BIRC5 (NP_001159) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MGAPTLPPAWQPFLKDHRISTFKNWPFLEGCACTPERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDDPIEEHKKHSSGCAFLSVKKQFEELTLGE
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB)

(Western Blot analysis of BIRC5 expression in transfected 293T cell line by BIRC5 monoclonal antibody. Lane 1: BIRC5 transfected lysate (16.4kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to BIRC5 on HeLa cell. [antibody concentration 10ug/ml].)

Immunoprecipitation (IP)

(Immunoprecipitation of BIRC5 transfected lysate using BIRC5 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with BIRC5 rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged BIRC5 is ~0.03ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of BIRC5 over-expressed 293 cell line, cotransfected with BIRC5 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with BIRC5 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Related Product Information for anti-BIRC5 antibody

Multitasking protein that has dual roles in promoting cell proliferation and preventing apoptosis. Component of a chromosome passage protein complex (CPC) which is essential for chromosome alignment and segregation during mitosis and cytokinesis. Acts as an important regulator of the localization of this complex; directs CPC movement to different locations from the inner centromere during prometaphase to midbody during cytokinesis and participates in the organization of the center spindle by associating with polymerized microtubules. The complex with RAN plays a role in mitotic spindle formation by serving as a physical scaffold to help deliver the RAN effector molecule TPX2 to microtubules. May counteract a default induction of apoptosis in G2/M phase. The acetylated form represses STAT3 transactivation of target gene promoters. May play a role in neoplasia. Inhibitor of CASP3 and CASP7. Isoform 2 and isoform 3 do not appear to play vital roles in mitosis. Isoform 3 shows a marked reduction in its anti-apoptotic effects when compared with the displayed wild-type isoform.

Product Categories/Family for anti-BIRC5 antibody

Antibodies; Apoptosis

References

1. Survivin expression induced by endothelin-1 promotes myofibroblast resistance to apoptosis. Horowitz JC, Ajayi IO, Kulasekaran P, Rogers DS, White JB, Townsend SK, White ES, Nho RS, Higgins PD, Huang SK, Sisson TH.Int J Biochem Cell Biol. 2011 Oct 25. 2. The Closely Related RNA helicases, UAP56 and URH49, Preferentially Form Distinct mRNA Export Machineries and Coordinately Regulate Mitotic Progression. Yamazaki T, Fujiwara N, Yukinaga H, Ebisuya M, Shiki T, Kurihara T, Kioka N, Kambe T, Nagao M, Nishida E, Masuda S.Mol Biol Cell. 2010 Aug 15;21(16):2953-65. Epub 2010 Jun 23.

NCBI and Uniprot Product Information

• NCBI GI #: 59859878
• NCBI GeneID: 332
• NCBI Accession #: NP_001159
• NCBI GenBank Nucleotide #: NM_001168
• UniProt Accession #: O15392; Q2I3N8; Q4VGX0; Q53F61; Q5MGC6; Q6FHL2; Q75SP2; Q9P2W8; A2SUH6; B2R4R1
• Molecular Weight: 17 kDa
• NCBI Official Full Name: baculoviral IAP repeat-containing protein 5 isoform 1
• NCBI Official Synonym Full Names: baculoviral IAP repeat containing 5
• NCBI Official Symbol: BIRC5
• NCBI Official Synonym Symbols: API4; EPR-1
• NCBI Protein Information: baculoviral IAP repeat-containing protein 5; apoptosis inhibitor 4; survivin variant 3 alpha; apoptosis inhibitor survivin
• UniProt Protein Name: Baculoviral IAP repeat-containing protein 5
• Protein Family: Baculoviral IAP repeat-containing protein
• UniProt Gene Name: BIRC5
• UniProt Synonym Gene Names: API4; IAP4
• UniProt Entry Name: BIRC5_HUMAN

NCBI Description

This gene is a member of the inhibitor of apoptosis (IAP) gene family, which encode negative regulatory proteins that prevent apoptotic cell death. IAP family members usually contain multiple baculovirus IAP repeat (BIR) domains, but this gene encodes proteins with only a single BIR domain. The encoded proteins also lack a C-terminus RING finger domain. Gene expression is high during fetal development and in most tumors, yet low in adult tissues. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jun 2011]

Uniprot Description

Survivin: an apoptosis inhibitor that is expressed during the G2/M phase of the cell cycle. Associates with the microtubules of the mitotic spindle and any disruption results in the loss of apoptosis activity. May play a role in neoplasia. Inhibitor of caspase-3 and caspase-7. Two splice variant isoforms have been described.

Protein type: Apoptosis

Chromosomal Location of Human Ortholog: 17q25

Cellular Component: centriole; nuclear chromosome; microtubule; spindle microtubule; cytoplasmic microtubule; cytoplasm; spindle; midbody; interphase microtubule organizing center; nucleus; cytosol; chromosome, pericentric region

Molecular Function: tubulin binding; identical protein binding; protein homodimerization activity; zinc ion binding; metal ion binding; microtubule binding; caspase inhibitor activity; ubiquitin-protein ligase activity; protein binding; enzyme binding; protein heterodimerization activity; chaperone binding; cysteine protease inhibitor activity; cofactor binding; Ran GTPase binding; cobalt ion binding

Biological Process: mitosis; transcription, DNA-dependent; spindle checkpoint; establishment of chromosome localization; regulation of signal transduction; cytokinesis; protein ubiquitination; negative regulation of caspase activity; positive regulation of mitotic cell cycle; protein amino acid phosphorylation; chromosome segregation; protein complex localization; cell division; positive regulation of cell proliferation; mitotic cell cycle; negative regulation of transcription, DNA-dependent; G2/M transition of mitotic cell cycle; positive regulation of exit from mitosis; negative regulation of apoptosis