Mouse anti-Human SURF5 Monoclonal Antibody | anti-MED22 antibody

SURF5 (MED22, Mediator of RNA Polymerase II Transcription Subunit 22, Mediator Complex Subunit 22, Surfeit Locus Protein 5, Surf-5, MGC48682)

Cat. Num. AAA6001797

• Gene Names: MED22; MED24; SURF5; surf-5
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: SURF5; Monoclonal Antibody; SURF5 (MED22; Mediator of RNA Polymerase II Transcription Subunit 22; Mediator Complex Subunit 22; Surfeit Locus Protein 5; Surf-5; MGC48682); Anti -SURF5 (MED22; anti-MED22 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3A9
• Specificity: Recognizes human SURF5.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MAQQRALPQSKETLLQSYNKRLKDDIKSIMDNFTEIIKTAKIEDETQVSRATQGEQDNYEMHVRAANIVRAGESLMKLVSDLKQFLILNDFPSVNEAIDQ

• Applicable Applications for anti-MED22 antibody: ELISA (EL/EIA), Western Blot (WB)
• Application Notes: Suitable for use in ELISA and Western Blot.
• Immunogen: Partial recombinant corresponding to aa1-101 from human SURF5 (NP_006743) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Related Product Information for anti-MED22 antibody

This gene is located in the surfeit gene cluster, a group of very tightly linked housekeeping genes that do not share sequence similarity. The gene is oriented in a head-to-head fashion with RPL7A (SURF3) and the two genes share a bidirectional promoter. The encoded proteins are localized to the cytoplasm. Two alternative transcript variants encoding different isoforms have been identified for this gene.

Product Categories/Family for anti-MED22 antibody

Antibodies; Abs to Enzymes; Polymerase

NCBI and Uniprot Product Information

• NCBI GI #: 3288468
• NCBI GeneID: 6837
• UniProt Accession #: Q15528; O76072; Q5T8U0; B3KW83; B3KWX4
• Molecular Weight: 22,221 Da
• NCBI Official Full Name: surf5b
• NCBI Official Synonym Full Names: mediator complex subunit 22
• NCBI Official Symbol: MED22
• NCBI Official Synonym Symbols: MED24; SURF5; surf-5
• NCBI Protein Information: mediator of RNA polymerase II transcription subunit 22; surfeit locus protein 5
• UniProt Protein Name: Mediator of RNA polymerase II transcription subunit 22
• Protein Family: Mediator of RNA polymerase II transcription
• UniProt Gene Name: MED22
• UniProt Synonym Gene Names: SURF5; Surf-5
• UniProt Entry Name: MED22_HUMAN

NCBI Description

This gene encodes a protein component of the mediator complex, which functions in the regulation of transcription by bridging interactions between gene-specific regulatory factors, RNA polymerase II, and general transcription factors. Alternatively spliced transcript variants encoding different isoforms have been observed. [provided by RefSeq, Jul 2013]

Uniprot Description

SURF5: Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. Belongs to the Mediator complex subunit 22 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription, coactivator/corepressor

Chromosomal Location of Human Ortholog: 9q34.2

Cellular Component: cytoplasm; Srb-mediator complex

Molecular Function: protein binding

Biological Process: transcription from RNA polymerase II promoter; regulation of transcription from RNA polymerase II promoter