Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (SUPT5H monoclonal antibody Western Blot analysis of SUPT5H expression in Hela NE.)

Mouse anti-Human SUPT5H Monoclonal Antibody | anti-SUPT5H antibody

SUPT5H (SPT5, SPT5H, Transcription Elongation Factor SPT5, DRB Sensitivity-inducing Factor 160kD Subunit, DRB Sensitivity-inducing Factor Large Subunit, Tat-cotransactivator 1 Protein, FLJ34157) (PE)

Gene Names
SUPT5H; SPT5; SPT5H; Tat-CT1
Reactivity
Human
Applications
ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SUPT5H; Monoclonal Antibody; SUPT5H (SPT5; SPT5H; Transcription Elongation Factor SPT5; DRB Sensitivity-inducing Factor 160kD Subunit; DRB Sensitivity-inducing Factor Large Subunit; Tat-cotransactivator 1 Protein; FLJ34157) (PE); anti-SUPT5H antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3F1
Specificity
Recognizes human SUPT5H.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-SUPT5H antibody
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa981-1088 from human SUPT5H (AAH24203) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TTDIQVKVRDTYLDTQVVGQTGVIRSVTGGMCSVYLKDSEKVVSISSEHLEPITPTKNNKVKVILGEDREATGVLLSIDGEDGIVRMDLDEQLKILNLRFLGKLLEA
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(SUPT5H monoclonal antibody Western Blot analysis of SUPT5H expression in Hela NE.)

Western Blot (WB) (SUPT5H monoclonal antibody Western Blot analysis of SUPT5H expression in Hela NE.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to SUPT5H on formalin-fixed paraffin-embedded human colon. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to SUPT5H on formalin-fixed paraffin-embedded human colon. [antibody concentration 3ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to SUPT5H on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to SUPT5H on HeLa cell. [antibody concentration 10ug/ml])
Product Categories/Family for anti-SUPT5H antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
120,499 Da
NCBI Official Full Name
Homo sapiens suppressor of Ty 5 homolog (S. cerevisiae), mRNA
NCBI Official Synonym Full Names
SPT5 homolog, DSIF elongation factor subunit
NCBI Official Symbol
SUPT5H
NCBI Official Synonym Symbols
SPT5; SPT5H; Tat-CT1
NCBI Protein Information
transcription elongation factor SPT5

Research Articles on SUPT5H

Similar Products

Product Notes

The SUPT5H (Catalog #AAA6160589) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SUPT5H (SPT5, SPT5H, Transcription Elongation Factor SPT5, DRB Sensitivity-inducing Factor 160kD Subunit, DRB Sensitivity-inducing Factor Large Subunit, Tat-cotransactivator 1 Protein, FLJ34157) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SUPT5H can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SUPT5H for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SUPT5H, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.