Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (SUPT5H monoclonal antibody (M03), clone 3B1 Western Blot analysis of SUPT5H expression in Hela S3 NE (Cat # L013V3).)

Mouse SUPT5H Monoclonal Antibody | anti-SUPT5H antibody

SUPT5H (Suppressor of Ty 5 Homolog (S. cerevisiae), FLJ34157, SPT5, SPT5H) (HRP)

Gene Names
SUPT5H; SPT5; SPT5H; Tat-CT1
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified
Synonyms
SUPT5H; Monoclonal Antibody; SUPT5H (Suppressor of Ty 5 Homolog (S. cerevisiae); FLJ34157; SPT5; SPT5H) (HRP); Suppressor of Ty 5 Homolog (S. cerevisiae); SPT5H; anti-SUPT5H antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3B1
Specificity
Recognizes SUPT5H.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Sequence Length
1087
Applicable Applications for anti-SUPT5H antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
SUPT5H (AAH24203, 981aa-1087aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TTDIQVKVRDTYLDTQVVGQTGVIRSVTGGMCSVYLKDSEKVVSISSEHLEPITPTKNNKVKVILGEDREATGVLLSIDGEDGIVRMDLDEQLKILNLRFLGKLLEA
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(SUPT5H monoclonal antibody (M03), clone 3B1 Western Blot analysis of SUPT5H expression in Hela S3 NE (Cat # L013V3).)

Western Blot (WB) (SUPT5H monoclonal antibody (M03), clone 3B1 Western Blot analysis of SUPT5H expression in Hela S3 NE (Cat # L013V3).)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to SUPT5H on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to SUPT5H on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to SUPT5H on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to SUPT5H on HeLa cell. [antibody concentration 10 ug/ml])
Product Categories/Family for anti-SUPT5H antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Suppressor of Ty 5 homolog (S. cerevisiae)
NCBI Official Synonym Full Names
SPT5 homolog, DSIF elongation factor subunit
NCBI Official Symbol
SUPT5H
NCBI Official Synonym Symbols
SPT5; SPT5H; Tat-CT1
NCBI Protein Information
transcription elongation factor SPT5

Research Articles on SUPT5H

Similar Products

Product Notes

The SUPT5H (Catalog #AAA6180166) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's SUPT5H can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SUPT5H for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SUPT5H, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.