Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.99kD).)

Mouse anti-Human SUPT16H Monoclonal Antibody | anti-SUPT16H antibody

SUPT16H (FACT Complex Subunit SPT16, CDC68 Chromatin-specific Transcription Elongation Factor 140kD Subunit, FACT 140kD Subunit, FACT140, FACTp140, Facilitates Chromatin Transcription Complex Subunit SPT16, hSPT16) (FITC)

Gene Names
SUPT16H; CDC68; SPT16; FACTP140; SPT16/CDC68
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SUPT16H; Monoclonal Antibody; SUPT16H (FACT Complex Subunit SPT16; CDC68 Chromatin-specific Transcription Elongation Factor 140kD Subunit; FACT 140kD Subunit; FACT140; FACTp140; Facilitates Chromatin Transcription Complex Subunit SPT16; hSPT16) (FITC); anti-SUPT16H antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1D12
Specificity
Recognizes human SUPT16H.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Sequence Length
4433
Applicable Applications for anti-SUPT16H antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa608-716 from SUPT16H (NP_009123) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PGEQTVPALNLQNAFRIIKEVQKRYKTREAEEKEKEGIVKQDSLVINLNRSNPKLKDLYIRPNIAQKRMQGSLEAHVNGFRFTSVRGDKVDILYNNIKHALFQPCDGE*
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.99kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.99kD).)

Western Blot (WB)

(SUPT16H monoclonal antibody Western Blot analysis of SUPT16H expression in Hela NE)

Western Blot (WB) (SUPT16H monoclonal antibody Western Blot analysis of SUPT16H expression in Hela NE)

Testing Data

(Detection limit for recombinant GST tagged SUPT16H is 0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SUPT16H is 0.03ng/ml as a capture antibody.)
Product Categories/Family for anti-SUPT16H antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens SPT16 homolog, facilitates chromatin remodeling subunit (SUPT16H), mRNA
NCBI Official Synonym Full Names
SPT16 homolog, facilitates chromatin remodeling subunit
NCBI Official Symbol
SUPT16H
NCBI Official Synonym Symbols
CDC68; SPT16; FACTP140; SPT16/CDC68
NCBI Protein Information
FACT complex subunit SPT16
UniProt Protein Name
FACT complex subunit SPT16
UniProt Gene Name
SUPT16H
UniProt Synonym Gene Names
FACT140; FACTP140; hSPT16
UniProt Entry Name
SP16H_HUMAN

NCBI Description

Transcription of protein-coding genes can be reconstituted on naked DNA with only the general transcription factors and RNA polymerase II. However, this minimal system cannot transcribe DNA packaged into chromatin, indicating that accessory factors may facilitate access to DNA. One such factor, FACT (facilitates chromatin transcription), interacts specifically with histones H2A/H2B to effect nucleosome disassembly and transcription elongation. FACT is composed of an 80 kDa subunit and a 140 kDa subunit; this gene encodes the 140 kDa subunit. [provided by RefSeq, Feb 2009]

Uniprot Description

SPT16: Component of the FACT complex, a general chromatin factor that acts to reorganize nucleosomes. The FACT complex is involved in multiple processes that require DNA as a template such as mRNA elongation, DNA replication and DNA repair. During transcription elongation the FACT complex acts as a histone chaperone that both destabilizes and restores nucleosomal structure. It facilitates the passage of RNA polymerase II and transcription by promoting the dissociation of one histone H2A-H2B dimer from the nucleosome, then subsequently promotes the reestablishment of the nucleosome following the passage of RNA polymerase II. The FACT complex is probably also involved in phosphorylation of 'Ser-392' of p53/TP53 via its association with CK2 (casein kinase II). Also involved in vitamin D-coupled transcription regulation via its association with the WINAC complex, a chromatin-remodeling complex recruited by vitamin D receptor (VDR), which is required for the ligand-bound VDR- mediated transrepression of the CYP27B1 gene. Belongs to the peptidase M24 family. SPT16 subfamily. Component of the FACT complex, a stable heterodimer of SSRP1 and SUPT16H. Also component of a CK2-SPT16-SSRP1 complex which forms following UV irradiation, composed of SSRP1, SUPT16H, CSNK2A1, CSNK2A2 and CSNK2B. Component of the WINAC complex, at least composed of SMARCA2, SMARCA4, SMARCB1, SMARCC1, SMARCC2, SMARCD1, SMARCE1, ACTL6A, BAZ1B/WSTF, ARID1A, SUPT16H, CHAF1A and TOP2B. Interacts with NEK9. Binds to histone H2A-H2B. Interacts with GTF2E2.

Protein type: Transcription initiation complex

Chromosomal Location of Human Ortholog: 14q11.2

Cellular Component: nucleoplasm; chromosome; nucleus

Molecular Function: protein binding

Biological Process: transcription from RNA polymerase II promoter; nucleosome disassembly; viral reproduction; positive regulation of viral transcription; positive regulation of RNA elongation; RNA elongation from RNA polymerase II promoter; gene expression; DNA replication; DNA repair

Research Articles on SUPT16H

Similar Products

Product Notes

The SUPT16H supt16h (Catalog #AAA6149981) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SUPT16H (FACT Complex Subunit SPT16, CDC68 Chromatin-specific Transcription Elongation Factor 140kD Subunit, FACT 140kD Subunit, FACT140, FACTp140, Facilitates Chromatin Transcription Complex Subunit SPT16, hSPT16) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SUPT16H can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SUPT16H supt16h for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SUPT16H, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.