Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human Sulfotransferase 4A1 Monoclonal Antibody | anti-ST4A1 antibody

Sulfotransferase 4A1 (ST4A1, SULT4A1, Brain Sulfotransferase-like Protein, BRSTL1, BR-STL-1, hBR-STL, hBR-STL-1, Nervous System Sulfotransferase, NST, SULTX3, DJ388M5.3) APC

Gene Names
SULT4A1; NST; BRSTL1; SULTX3; BR-STL-1; DJ388M5.3; hBR-STL-1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Sulfotransferase 4A1; Monoclonal Antibody; Sulfotransferase 4A1 (ST4A1; SULT4A1; Brain Sulfotransferase-like Protein; BRSTL1; BR-STL-1; hBR-STL; hBR-STL-1; Nervous System Sulfotransferase; NST; SULTX3; DJ388M5.3) APC; EC=2.8.2.-; anti-ST4A1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3C1
Specificity
Recognizes human SULT4A1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
2478
Applicable Applications for anti-ST4A1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
ELISA: 1ng/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-101 from human SULT4A1 (NP_055166) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAESEAETPSTPGEFESKYFEFHGVRLPPFCRGKMEEIANFPVRPSDVWIVTYPKSGTSLLQEVVYLVSQGADPDEIGLMNIDEQLPVLEYPQPGLDIIK*
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB)

(Western Blot analysis of SULT4A1 expression in transfected 293T cell line by SULT4A1 monoclonal antibody. Lane 1: SULT4A1 transfected lysate (33kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of SULT4A1 expression in transfected 293T cell line by SULT4A1 monoclonal antibody. Lane 1: SULT4A1 transfected lysate (33kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged SULT4A1 is 1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SULT4A1 is 1ng/ml as a capture antibody.)
Product Categories/Family for anti-ST4A1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens sulfotransferase family 4A member 1 (SULT4A1), mRNA
NCBI Official Synonym Full Names
sulfotransferase family 4A member 1
NCBI Official Symbol
SULT4A1
NCBI Official Synonym Symbols
NST; BRSTL1; SULTX3; BR-STL-1; DJ388M5.3; hBR-STL-1
NCBI Protein Information
sulfotransferase 4A1
UniProt Protein Name
Sulfotransferase 4A1
Protein Family
UniProt Gene Name
SULT4A1
UniProt Synonym Gene Names
SULTX3
UniProt Entry Name
ST4A1_HUMAN

NCBI Description

This gene encodes a member of the sulfotransferase family. The encoded protein is a brain-specific sulfotransferase believed to be involved in the metabolism of neurotransmitters. Polymorphisms in this gene may be associated with susceptibility to schizophrenia. [provided by RefSeq, Jul 2008]

Uniprot Description

SULT4A1: Atypical sulfotransferase family member with very low affinity for 3'-phospho-5'-adenylyl sulfate (PAPS) and very low catalytic activity towards L-triiodothyronine, thyroxine, estrone, p-nitrophenol, 2-naphthylamine, and 2-beta-naphthol. May have a role in the metabolism of drugs and neurotransmitters in the CNS. Belongs to the sulfotransferase 1 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 2.8.2.-; Transferase

Chromosomal Location of Human Ortholog: 22q13.2

Cellular Component: cytosol

Molecular Function: sulfotransferase activity; protein binding

Biological Process: steroid metabolic process; xenobiotic metabolic process; 3'-phosphoadenosine 5'-phosphosulfate metabolic process

Research Articles on ST4A1

Similar Products

Product Notes

The ST4A1 sult4a1 (Catalog #AAA6139369) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Sulfotransferase 4A1 (ST4A1, SULT4A1, Brain Sulfotransferase-like Protein, BRSTL1, BR-STL-1, hBR-STL, hBR-STL-1, Nervous System Sulfotransferase, NST, SULTX3, DJ388M5.3) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Sulfotransferase 4A1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). ELISA: 1ng/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ST4A1 sult4a1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Sulfotransferase 4A1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.