Mouse SUGT1 Monoclonal Antibody | anti-SUGT1 antibody

SUGT1 (SGT1, Suppressor of G2 allele of SKP1 (S. cerevisiae), SGT1) (HRP)

Cat. Num. AAA6181560

• Gene Names: SUGT1; SGT1
• Applications: ELISA, Immunoprecipitation, Western Blot
• Purity: Purified
• Synonyms: SUGT1; Monoclonal Antibody; SUGT1 (SGT1; Suppressor of G2 allele of SKP1 (S. cerevisiae); SGT1) (HRP); SGT1; anti-SUGT1 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG3,k
• Clone Number: 1A10
• Specificity: Recognizes SUGT1.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-SUGT1 antibody: ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: SUGT1 (NP_006695, 151aa-260aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: VVITLMIKNVQKNDVNVEFSEKELSALVKLPSGEDYNLKLELLHPIIPEQSTFKVLSTKIEIKLKKPEAVRWEKLEGQGDVPTPKQFVADVKNLYPSSSPYTRNWDKLVG
• Conjugate: HRP
• Preparation and Storage: May be stored at 4 degree C. For long-term storage, aliquot and store at 4 degree C. Do not freeze. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(SUGT1 monoclonal antibody (M04), clone 1A10. Western Blot analysis of SUGT1 expression in PC-12.)

Western Blot (WB)

(SUGT1 monoclonal antibody (M04), clone 1A10. Western Blot analysis of SUGT1 expression in Raw 264.7.)

Immunoprecipitation (IP)

(Immunoprecipitation of SUGT1 transfected lysate using anti-SUGT1 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with SUGT1 monoclonal antibody.)

Western Blot (WB)

(Western Blot analysis of SUGT1 expression in transfected 293T cell line by SUGT1 monoclonal antibody (M04), clone 1A10.Lane 1: SUGT1 transfected lysate (Predicted MW: 37.8 KDa).Lane 2: Non-transfected lysate.)

Related Product Information for anti-SUGT1 antibody

This gene is homologous to the yeast gene SGT1, which encodes a protein involved in kinetochore function and required for the G1/S and G2/M transitions. Complementation studies suggest that the human protein has similar functions. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Product Categories/Family for anti-SUGT1 antibody

Antibodies; Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 5730041
• NCBI GeneID: 10910
• NCBI Accession #: NP_006695
• NCBI GenBank Nucleotide #: NM_006704
• UniProt Accession #: Q9Y2Z0; Q5JAK5; Q5TAM6; Q6VXY6; A2A303
• Molecular Weight: 37,805 Da
• NCBI Official Full Name: suppressor of G2 allele of SKP1 homolog isoform SGT1A
• NCBI Official Synonym Full Names: SGT1, suppressor of G2 allele of SKP1 (S. cerevisiae)
• NCBI Official Symbol: SUGT1
• NCBI Official Synonym Symbols: SGT1
• NCBI Protein Information: suppressor of G2 allele of SKP1 homolog; SGT1B protein; putative 40-6-3 protein; suppressor of G2 allele of SKP1, S. cerevisiae, homolog of
• UniProt Protein Name: Suppressor of G2 allele of SKP1 homolog
• UniProt Gene Name: SUGT1
• UniProt Entry Name: SUGT1_HUMAN

Uniprot Description

SUGT1: a protein involved in kinetochore function and required for the G1/S and G2/M transitions. A subunit of both core kinetochore and SCF (Skp1-Cul1-F-box) ubiquitin ligase complexes. Two alternatively spliced isoforms have been reported.

Protein type: Ubiquitin conjugating system; Cell cycle regulation

Chromosomal Location of Human Ortholog: 13q14.3

Cellular Component: kinetochore; cytoplasm; cytosol; nucleus; ubiquitin ligase complex

Molecular Function: protein binding

Biological Process: mitosis; innate immune response