Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (STX4A monoclonal antibody, Western Blot analysis of STX4A expression in HeLa.)

Mouse anti-Human, Mouse STX4 Monoclonal Antibody | anti-STX4 antibody

STX4 (STX4A, Syntaxin-4, Renal Carcinoma Antigen NY-REN-31) (PE)

Gene Names
STX4; STX4A; p35-2
Reactivity
Human, Mouse
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
STX4; Monoclonal Antibody; STX4 (STX4A; Syntaxin-4; Renal Carcinoma Antigen NY-REN-31) (PE); anti-STX4 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
6D1
Specificity
Recognizes human STX4A. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-STX4 antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa19-120 from human STX4A (NP_004595) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DKERVALVVHPGTARLGSPDEEFFHKVRTIRQTIVKLGNKVQELEKQQVTILATPLPEESMKQELQNLRDEIKQLGREIRLQLKAIEPQKEEADENYNSVN
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(STX4A monoclonal antibody, Western Blot analysis of STX4A expression in HeLa.)

Western Blot (WB) (STX4A monoclonal antibody, Western Blot analysis of STX4A expression in HeLa.)

Western Blot (WB)

(STX4A monoclonal antibody. Western Blot analysis of STX4A expression in Raw 264.7.)

Western Blot (WB) (STX4A monoclonal antibody. Western Blot analysis of STX4A expression in Raw 264.7.)

Western Blot (WB)

(STX4A monoclonal antibody. Western Blot analysis of STX4A expression in NIH/3T3.)

Western Blot (WB) (STX4A monoclonal antibody. Western Blot analysis of STX4A expression in NIH/3T3.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to STX4A on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to STX4A on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged STX4A is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged STX4A is ~0.1ng/ml as a capture antibody.)
Product Categories/Family for anti-STX4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34.7 kDa (300aa), confirmed by MALDI-TOF
NCBI Official Full Name
syntaxin-4 isoform 3
NCBI Official Synonym Full Names
syntaxin 4
NCBI Official Symbol
STX4
NCBI Official Synonym Symbols
STX4A; p35-2
NCBI Protein Information
syntaxin-4
UniProt Protein Name
Syntaxin-4
UniProt Gene Name
STX4
UniProt Synonym Gene Names
STX4A
UniProt Entry Name
STX4_HUMAN

Uniprot Description

STX4: a protein of the syntaxin/epimorphin family. Contains 1 t-SNARE coiled-coil homology domain. Potentially involved in docking of synaptic vesicles at presynaptic active zones. Interacts with SNAP23 and SNAP25BP. Found in a complex with VAMP8 and SNAP23 in pancreas.

Protein type: Vesicle; Membrane protein, integral

Chromosomal Location of Human Ortholog: 16p11.2

Cellular Component: extracellular space; specific granule; cell surface; lateral loop; basolateral plasma membrane; integral to membrane; dendritic spine; trans-Golgi network; cytosol; SNARE complex; synaptic vesicle; membrane; perinuclear region of cytoplasm; lamellipodium; plasma membrane; vacuole; synapse; intracellular; endosome

Molecular Function: sphingomyelin phosphodiesterase activator activity; SNAP receptor activity; SNARE binding; protein binding

Biological Process: positive regulation of catalytic activity; platelet activation; positive regulation of cell adhesion; organelle fusion; positive regulation of eosinophil degranulation; positive regulation of chemotaxis; positive regulation of immunoglobulin secretion; synaptic vesicle fusion to presynaptic membrane; regulation of exocytosis; intracellular protein transport; response to hydroperoxide; vesicle docking; positive regulation of cell proliferation; post-Golgi vesicle-mediated transport; blood coagulation; positive regulation of cell migration

Research Articles on STX4

Similar Products

Product Notes

The STX4 stx4 (Catalog #AAA6160568) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The STX4 (STX4A, Syntaxin-4, Renal Carcinoma Antigen NY-REN-31) (PE) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's STX4 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the STX4 stx4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "STX4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.