Mouse anti-Human Stonin 1 Monoclonal Antibody | anti-STON1 antibody
Stonin 1 (Stonin-1, STON1, STN1, SALF, Stoned B-like Factor, SBLF, STNB1) (MaxLight 405)
Gene Names
STON1-GTF2A1L; ALF; SALF; GTF2A1L; GTF2A1LF
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Stonin 1; Monoclonal Antibody; Stonin 1 (Stonin-1; STON1; STN1; SALF; Stoned B-like Factor; SBLF; STNB1) (MaxLight 405); anti-STON1 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
5F12
Specificity
Recognizes human SALF.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Applicable Applications for anti-STON1 antibody
FLISA, Western Blot (WB)
Application Notes
Sandwich FLISA: The detection limit is ~0.03ng/ml as a capture antibody.
Applications are based on unconjugated antibody.
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa141-250 from human SALF (NP_758515) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SCTHPTPKVGLPDEVNPQQAESLGFQSDDLPQFQYFREDCAFSSPFWKDEGSDSHFTLDPPGSKKMFSSRNKEMPIDQKSLNKCSLNYICEKLEHLQSAENQDSLRSLS*
Conjugate
MaxLight405
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Product Categories/Family for anti-STON1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
132kDa
NCBI Official Full Name
STON1-GTF2A1L protein isoform 1
NCBI Official Synonym Full Names
STON1-GTF2A1L readthrough
NCBI Official Symbol
STON1-GTF2A1L
NCBI Official Synonym Symbols
ALF; SALF; GTF2A1L; GTF2A1LF
NCBI Protein Information
STON1-GTF2A1L protein
Protein Family
NCBI Description
STON1-GTF2A1L mRNAs are infrequent but naturally occurring read-through products of the neighboring STON1 and GTF2A1L genes. These transcripts encode fusion proteins composed of the vast majority of each of the individual elements, stonin 1 and general transcription factor IIA, 1-like. Alternative splicing results in multiple transcript variants. The significance of these read-through variants and the function of the resulting protein products have not yet been determined. [provided by RefSeq, Oct 2010]
Similar Products
Product Notes
The STON1 (Catalog #AAA6192462) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Stonin 1 (Stonin-1, STON1, STN1, SALF, Stoned B-like Factor, SBLF, STNB1) (MaxLight 405) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Stonin 1 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Sandwich FLISA: The detection limit is ~0.03ng/ml as a capture antibody. Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the STON1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Stonin 1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
