Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged STMN2 is approximately 1ng/ml as a capture antibody.)

Mouse STMN2 Monoclonal Antibody | anti-STMN2 antibody

STMN2 (Stathmin-like 2, SCG10, SCGN10, SGC10) (APC)

Gene Names
STMN2; SCG10; SCGN10
Applications
ELISA
Purity
Purified
Synonyms
STMN2; Monoclonal Antibody; STMN2 (Stathmin-like 2; SCG10; SCGN10; SGC10) (APC); Stathmin-like 2; SGC10; anti-STMN2 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
1D3
Specificity
Recognizes STMN2.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-STMN2 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
STMN2 (NP_008960, 1aa-90aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAKTAMAYKEKMKELSMLSLICSCFYPEPRNINIYTYDDMEVKQINKRASGQAFELILKPPSPISEAPRTLASPKKKDLSLEEIQKKLEA
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged STMN2 is approximately 1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged STMN2 is approximately 1ng/ml as a capture antibody.)
Related Product Information for anti-STMN2 antibody
Superior cervical ganglion-10 is a neuronal growth-associated protein that shares significant amino acid sequence similarity with the phosphoprotein stathmin (MIM 151442). [supplied by OMIM]
Product Categories/Family for anti-STMN2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
16.4 kDa (142aa), confirmed by MALDI-TOF.
NCBI Official Full Name
stathmin-2 isoform 2
NCBI Official Synonym Full Names
stathmin 2
NCBI Official Symbol
STMN2
NCBI Official Synonym Symbols
SCG10; SCGN10
NCBI Protein Information
stathmin-2
UniProt Protein Name
Stathmin-2
Protein Family
UniProt Gene Name
STMN2
UniProt Synonym Gene Names
SCG10; SCGN10; Protein SCG10
UniProt Entry Name
STMN2_HUMAN

NCBI Description

This gene encodes a member of the stathmin family of phosphoproteins. Stathmin proteins function in microtubule dynamics and signal transduction. The encoded protein plays a regulatory role in neuronal growth and is also thought to be involved in osteogenesis. Reductions in the expression of this gene have been associated with Down's syndrome and Alzheimer's disease. Alternatively spliced transcript variants have been observed for this gene. A pseudogene of this gene is located on the long arm of chromosome 6. [provided by RefSeq, Nov 2010]

Uniprot Description

STMN2: a cytoskeletal protein that may play a role in neuronal differentiation, and in modulating membrane interaction with the cytoskeleton during neurite outgrowth. Associated with punctate structures in the perinuclear cytoplasm, axons, and growth cones of developing neurons. Neuron specific.

Protein type: Cytoskeletal

Chromosomal Location of Human Ortholog: 8q21.13

Cellular Component: Golgi apparatus; neuron projection; growth cone; cell soma; membrane; perinuclear region of cytoplasm; axon; lamellipodium; cytoplasm; vesicle; endosome

Molecular Function: tubulin binding; protein binding; calcium-dependent protein binding

Biological Process: positive regulation of microtubule depolymerization; negative regulation of microtubule depolymerization; negative regulation of microtubule polymerization

Research Articles on STMN2

Similar Products

Product Notes

The STMN2 stmn2 (Catalog #AAA6166440) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's STMN2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the STMN2 stmn2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "STMN2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.