Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (STK4 monoclonal antibody, Western Blot analysis of STK4 expression in Hela NE.)

Mouse anti-Human STK4 Monoclonal Antibody | anti-STK4 antibody

STK4 (Serine/Threonine-protein Kinase 4, STE20-like Kinase MST1, Mammalian STE20-like Protein Kinase 1, MST-1, Serine/Threonine-Protein Kinase Krs-2, MST1, DKFZp686A2068) (Biotin)

Gene Names
STK4; KRS2; MST1; YSK3
Reactivity
Human
Applications
ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
STK4; Monoclonal Antibody; STK4 (Serine/Threonine-protein Kinase 4; STE20-like Kinase MST1; Mammalian STE20-like Protein Kinase 1; MST-1; Serine/Threonine-Protein Kinase Krs-2; MST1; DKFZp686A2068) (Biotin); anti-STK4 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1D7-8A10
Specificity
Recognizes human STK4.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-STK4 antibody
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-40 from human STK4 (AAH05231) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
METVQLRNPPRRQLKKLDEDSLTKQPEEVFDVLEKLGEG
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(STK4 monoclonal antibody, Western Blot analysis of STK4 expression in Hela NE.)

Western Blot (WB) (STK4 monoclonal antibody, Western Blot analysis of STK4 expression in Hela NE.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to STK4 on formalin-fixed paraffin-embedded human stomach carcinoma tissue. [antibody concentration 5ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to STK4 on formalin-fixed paraffin-embedded human stomach carcinoma tissue. [antibody concentration 5ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to STK4 on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to STK4 on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged STK4 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged STK4 is ~0.03ng/ml as a capture antibody.)
Product Categories/Family for anti-STK4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
52,335 Da
NCBI Official Full Name
Homo sapiens serine/threonine kinase 4, mRNA
NCBI Official Synonym Full Names
serine/threonine kinase 4
NCBI Official Symbol
STK4
NCBI Official Synonym Symbols
KRS2; MST1; YSK3
NCBI Protein Information
serine/threonine-protein kinase 4

NCBI Description

The protein encoded by this gene is a cytoplasmic kinase that is structurally similar to the yeast Ste20p kinase, which acts upstream of the stress-induced mitogen-activated protein kinase cascade. The encoded protein can phosphorylate myelin basic protein and undergoes autophosphorylation. A caspase-cleaved fragment of the encoded protein has been shown to be capable of phosphorylating histone H2B. The particular phosphorylation catalyzed by this protein has been correlated with apoptosis, and it's possible that this protein induces the chromatin condensation observed in this process. [provided by RefSeq, Jul 2008]

Research Articles on STK4

Similar Products

Product Notes

The STK4 (Catalog #AAA6144646) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The STK4 (Serine/Threonine-protein Kinase 4, STE20-like Kinase MST1, Mammalian STE20-like Protein Kinase 1, MST-1, Serine/Threonine-Protein Kinase Krs-2, MST1, DKFZp686A2068) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's STK4 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the STK4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "STK4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.