Mouse STK24 Monoclonal Antibody | anti-STK24 antibody

STK24 (Serine/Threonine Kinase 24 (STE20 Homolog, yeast), MST-3, MST3, MST3B, STE20, STK3) (PE)

Cat. Num. AAA6186474

• Gene Names: STK24; MST3; STK3; MST3B; STE20; HEL-S-95
• Applications: Immunofluorescence, Western Blot
• Purity: Purified
• Synonyms: STK24; Monoclonal Antibody; STK24 (Serine/Threonine Kinase 24 (STE20 Homolog; yeast); MST-3; MST3; MST3B; STE20; STK3) (PE); Serine/Threonine Kinase 24 (STE20 Homolog; STK3; anti-STK24 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3F2
• Specificity: Recognizes STK24.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
• Sequence Length: 431

• Applicable Applications for anti-STK24 antibody: Immunofluorescence (IF), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: STK24 (AAH35578, 1aa-431aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MAHSPVQSGLPGMQNLKADPEELFTKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLLEPGPLDETQIATILREILKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELARGEPPHSELHPMKVLFLIPKNNPPTLEGNYSKPLKEFVEACLNKEPSFRPTAKELLKHKFILRNAKKTSYLTELIDRYKRWKAEQSHDDSSSEDSDAETDGQASGGSDSGDWIFTIREKDPKNLENGALQPSDLDRNKMKDIPKRPFSQCLSTIISPLFAELKEKSQACGGNLGSIEELRGAIYLAEEACPGISDTMVAQLVQRLQRYSLSGGGTSSH
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged STK24 is approximately 1ng/ml as a capture antibody.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to STK24 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to STK24 on HeLa cell. [antibody concentration 10 ug/ml])

Related Product Information for anti-STK24 antibody

The yeast 'Sterile 20' gene (STE20) functions upstream of the mitogen-activated protein kinase (MAPK) cascade. In mammals, protein kinases related to STE20 can be divided into 2 subfamilies based on their structure and regulation. Members of the PAK subfamily (see PAK3; MIM 300142) contain a C-terminal catalytic domain and an N-terminal regulatory domain that has a CDC42 (MIM 116952)-binding domain. In contrast, members of the GCK subfamily (see MAP4K2; MIM 603166), also called the Sps1 subfamily, have an N-terminal catalytic domain and a C-terminal regulatory domain without a CDC42-binding domain. STK24 belongs to the GCK subfamily of STE20-like kinases (Zhou et al., 2000 [PubMed 10644707]). [supplied by OMIM]

Product Categories/Family for anti-STK24 antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 23274191
• NCBI GeneID: 8428
• NCBI Official Full Name: Serine/threonine kinase 24 (STE20 homolog, yeast)
• NCBI Official Synonym Full Names: serine/threonine kinase 24
• NCBI Official Symbol: STK24
• NCBI Official Synonym Symbols: MST3; STK3; MST3B; STE20; HEL-S-95
• NCBI Protein Information: serine/threonine-protein kinase 24
• Protein Family: Serine/threonine-protein kinase

NCBI Description

This gene encodes a serine/threonine protein kinase that functions upstream of mitogen-activated protein kinase (MAPK) signaling. The encoded protein is cleaved into two chains by caspases; the N-terminal fragment (MST3/N) translocates to the nucleus and promotes programmed cells death. There is a pseudogene for this gene on chromosome X. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2013]