Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunoprecipitation (IP) (Immunoprecipitation of STK19 transfected lysate using STK19 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with STK19 rabbit polyclonal antibody.)

Mouse anti-Human STK19 Monoclonal Antibody | anti-STK19 antibody

STK19 (Serine/threonine-protein Kinase 19, G11, Protein G11, Protein RP1, RP1) (FITC)

Reactivity
Human
Applications
ELISA, Immunoprecipitation
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
STK19; Monoclonal Antibody; STK19 (Serine/threonine-protein Kinase 19; G11; Protein G11; Protein RP1; RP1) (FITC); EC=2.7.11.1; D6S60; D6S60E; HLA-RP1; anti-STK19 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4E11
Specificity
Recognizes human STK19.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Sequence Length
364
Applicable Applications for anti-STK19 antibody
ELISA (EIA), Immunoprecipitation (IP)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa255-365 from STK19 (NP_004188) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
QMTQTFGFRDSEITHLVNAGVLTVRDAGSWWLAVPGAGRFIKYFVKGRQAVLSMVRKAKYRELLLSELLGRRAPVVVRLGLTYHVHDLIGAQLVDCISTTSGTLLRLPET
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Immunoprecipitation (IP)

(Immunoprecipitation of STK19 transfected lysate using STK19 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with STK19 rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of STK19 transfected lysate using STK19 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with STK19 rabbit polyclonal antibody.)
Product Categories/Family for anti-STK19 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
serine/threonine-protein kinase 19 isoform 1
UniProt Protein Name
Serine/threonine-protein kinase 19
UniProt Gene Name
STK19
UniProt Synonym Gene Names
G11; RP1
UniProt Entry Name
STK19_HUMAN

Uniprot Description

G11: an atypical protein kinase. Encoded within the major histocompatibility complex. Four alternatively spliced isoforms have been described.

Protein type: Protein kinase, Ser/Thr (non-receptor); Protein kinase, atypical; EC 2.7.11.1; Kinase, protein; ATYPICAL group; G11 family

Chromosomal Location of Human Ortholog: 6p21.3

Cellular Component: nucleus

Molecular Function: protein serine/threonine kinase activity; ATP binding

Biological Process: protein amino acid phosphorylation

Similar Products

Product Notes

The STK19 stk19 (Catalog #AAA6149940) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The STK19 (Serine/threonine-protein Kinase 19, G11, Protein G11, Protein RP1, RP1) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's STK19 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunoprecipitation (IP). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the STK19 stk19 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "STK19, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.