Mouse STAT6 Monoclonal Antibody | anti-STAT6 antibody

STAT6 (Signal Transducer and Activator of Transcription 6, Interleukin-4 Induced, D12S1644, IL-4-STAT, STAT6B, STAT6C) (HRP)

Cat. Num. AAA6182497

• Gene Names: STAT6; STAT6B; STAT6C; D12S1644; IL-4-STAT
• Applications: Immunofluorescence, Western Blot
• Purity: Purified
• Synonyms: STAT6; Monoclonal Antibody; STAT6 (Signal Transducer and Activator of Transcription 6; Interleukin-4 Induced; D12S1644; IL-4-STAT; STAT6B; STAT6C) (HRP); Signal Transducer and Activator of Transcription 6; STAT6C; anti-STAT6 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4G7
• Specificity: Recognizes STAT6.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-STAT6 antibody: Immunofluorescence (IF), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: STAT6 (NP_003144, 694aa-801aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: PPHSHSIPPYQGLSPEESVNVLSAFQEPHLQMPPSLGQMSLPFDQPHPQGLLPCQPQEHAVSSPDPLLCSDVTMVEDSCLSQPVTAFPQGTWIGEDIFPPLLPPTEQD
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(STAT6 monoclonal antibody (M09), clone 4G7. Western Blot analysis of STAT6 expression in Hela S3 NE.)

Testing Data

(Detection limit for recombinant GST tagged STAT6 is 0.03 ng/ml as a capture antibody.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to STAT6 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to STAT6 on HeLa cell. [antibody concentration 10 ug/ml])

Product Categories/Family for anti-STAT6 antibody

Antibodies; Interleukin

NCBI and Uniprot Product Information

• NCBI GI #: 23397678
• NCBI GeneID: 6778
• NCBI Accession #: NP_003144
• NCBI GenBank Nucleotide #: NM_003153.4
• Molecular Weight: 81,748 Da
• NCBI Official Full Name: signal transducer and activator of transcription 6 isoform 1
• NCBI Official Synonym Full Names: signal transducer and activator of transcription 6, interleukin-4 induced
• NCBI Official Symbol: STAT6
• NCBI Official Synonym Symbols: STAT6B; STAT6C; D12S1644; IL-4-STAT
• NCBI Protein Information: signal transducer and activator of transcription 6
• Protein Family: Signal transducer and transcription activator

NCBI Description

The protein encoded by this gene is a member of the STAT family of transcription factors. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein plays a central role in exerting IL4 mediated biological responses. It is found to induce the expression of BCL2L1/BCL-X(L), which is responsible for the anti-apoptotic activity of IL4. Knockout studies in mice suggested the roles of this gene in differentiation of T helper 2 (Th2) cells, expression of cell surface markers, and class switch of immunoglobulins. Alternative splicing results in multiple transcript variants.[provided by RefSeq, May 2010]