Mouse anti-Human STAT5B Monoclonal Antibody | anti-STAT5B antibody

STAT5B (Signal Transducer and Activator of Transcription 5B) (Biotin)

Cat. Num. AAA6144625

• Gene Names: STAT5B; STAT5
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: STAT5B; Monoclonal Antibody; STAT5B (Signal Transducer and Activator of Transcription 5B) (Biotin); anti-STAT5B antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 5D6
• Specificity: Recognizes human STAT5B.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-STAT5B antibody: ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
• Application Notes: IF: 25ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa678-788 from human STAT5B (NP_036580) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: VYSKYYTPVPCESATAKAVDGYVKPQIKQVVPEFVNASADAGGGSATYMDQAPSPAVCPQAHYNMYPQNPDSVLDTDGDFDLEDTMDVARRVEELLGRPMDSQWIPHAQS
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(STAT5B monoclonal antibody, Western Blot analysis of STAT5B expression in HeLa.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to STAT5B on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 2ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to STAT5B on HeLa cell. [antibody concentration 25ug/ml])

Testing Data

(Detection limit for recombinant GST tagged STAT5B is ~0.3ng/ml as a capture antibody.)

Product Categories/Family for anti-STAT5B antibody

Antibodies; Transcription Factors; STAT

NCBI and Uniprot Product Information

• NCBI GI #: 21618344
• NCBI GeneID: 6777
• NCBI Accession #: NP_036580
• NCBI GenBank Nucleotide #: NM_012448
• UniProt Accession #: P51692
• Molecular Weight: 90kDa
• NCBI Official Full Name: signal transducer and activator of transcription 5B
• NCBI Official Synonym Full Names: signal transducer and activator of transcription 5B
• NCBI Official Symbol: STAT5B
• NCBI Official Synonym Symbols: STAT5
• NCBI Protein Information: signal transducer and activator of transcription 5B
• UniProt Protein Name: Signal transducer and activator of transcription 5B
• Protein Family: Signal transducer and activator of transcription
• UniProt Gene Name: STAT5B
• UniProt Entry Name: STA5B_HUMAN

NCBI Description

The protein encoded by this gene is a member of the STAT family of transcription factors. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein mediates the signal transduction triggered by various cell ligands, such as IL2, IL4, CSF1, and different growth hormones. It has been shown to be involved in diverse biological processes, such as TCR signaling, apoptosis, adult mammary gland development, and sexual dimorphism of liver gene expression. This gene was found to fuse to retinoic acid receptor-alpha (RARA) gene in a small subset of acute promyelocytic leukemias (APLL). The dysregulation of the signaling pathways mediated by this protein may be the cause of the APLL. [provided by RefSeq, Jul 2008]

Uniprot Description

STAT5B: transcription factor of the STAT family. Phosphorylated and activated by receptor-associated kinases triggered by cytokines including IL2, IL3, GM-CSF, and various growth hormones. It has been shown to be involved in diverse biological processes, such as TCR signaling, apoptosis, adult mammary gland development, and sexual dimorphism of liver gene expression. Forms homo- or heterodimers that translocate into the nucleus where they regulate transcription.

Protein type: DNA-binding; Oncoprotein; Transcription factor

Chromosomal Location of Human Ortholog: 17q11.2

Cellular Component: nucleoplasm; cytoplasm; cytosol; nucleus

Molecular Function: protein dimerization activity; protein binding; signal transducer activity; double-stranded DNA binding; chromatin binding; transcription factor activity; protein phosphatase binding; glucocorticoid receptor binding

Biological Process: positive regulation of interleukin-2 biosynthetic process; T cell differentiation in the thymus; response to lipopolysaccharide; positive regulation of multicellular organism growth; female pregnancy; 2-oxoglutarate metabolic process; sequestering of lipid; natural killer cell differentiation; allantoin metabolic process; regulation of steroid metabolic process; acute-phase response; T cell homeostasis; Peyer's patch development; isoleucine metabolic process; positive regulation of natural killer cell proliferation; valine metabolic process; development of secondary female sexual characteristics; JAK-STAT cascade; regulation of transcription from RNA polymerase II promoter; response to ethanol; regulation of epithelial cell differentiation; positive regulation of transcription from RNA polymerase II promoter; taurine metabolic process; negative regulation of apoptosis; transcription from RNA polymerase II promoter; lactation; succinate metabolic process; oxaloacetate metabolic process; positive regulation of smooth muscle cell proliferation; progesterone metabolic process; positive regulation of activated T cell proliferation; positive regulation of mitotic cell cycle; fatty acid metabolic process; response to estradiol stimulus; positive regulation of natural killer cell differentiation; luteinization; development of secondary male sexual characteristics; creatinine metabolic process; positive regulation of gamma-delta T cell differentiation; negative regulation of erythrocyte differentiation; regulation of multicellular organism growth; citrate metabolic process; positive regulation of cell motility; positive regulation of natural killer cell mediated cytotoxicity; liver development; creatine metabolic process; cellular response to hormone stimulus; response to hypoxia; positive regulation of B cell differentiation; positive regulation of inflammatory response

Disease: Growth Hormone Insensitivity With Immunodeficiency