Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to STAT5B on HeLa cell. [antibody concentration 10 ug/ml])

Mouse STAT5B Monoclonal Antibody | anti-STAT5B antibody

STAT5B (Signal Transducer and Activator of Transcription 5B, STAT5) (Biotin)

Gene Names
STAT5B; STAT5
Applications
Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified
Synonyms
STAT5B; Monoclonal Antibody; STAT5B (Signal Transducer and Activator of Transcription 5B; STAT5) (Biotin); Signal Transducer and Activator of Transcription 5B; STAT5; anti-STAT5B antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2D1
Specificity
Recognizes STAT5B.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-STAT5B antibody
Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
STAT5B (NP_036580, 678aa-787aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
VYSKYYTPVPCESATAKAVDGYVKPQIKQVVPEFVNASADAGGGSATYMDQAPSPAVCPQAHYNMYPQNPDSVLDTDGDFDLEDTMDVARRVEELLGRPMDSQWIPHAQS
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to STAT5B on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to STAT5B on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to STAT5B on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to STAT5B on HeLa cell. [antibody concentration 10 ug/ml])

Western Blot (WB)

(STAT5B monoclonal antibody (M03), clone 2D1 Western Blot analysis of STAT5B expression in HeLa.)

Western Blot (WB) (STAT5B monoclonal antibody (M03), clone 2D1 Western Blot analysis of STAT5B expression in HeLa.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to STAT5B on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 1.5 ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to STAT5B on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 1.5 ug/ml])

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to STAT5B on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 1.5 ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to STAT5B on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 1.5 ug/ml])

Testing Data

(Detection limit for recombinant GST tagged STAT5B is approximately 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged STAT5B is approximately 0.3ng/ml as a capture antibody.)
Related Product Information for anti-STAT5B antibody
The protein encoded by this gene is a member of the STAT family of transcription factors. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein mediates the signal transduction triggered by various cell ligands, such as IL2, IL4, CSF1, and different growth hormones. It has been shown to be involved in diverse biological processes, such as TCR signaling, apoptosis, adult mammary gland development, and sexual dimorphism of liver gene expression. This gene was found to fuse to retinoic acid receptor-alpha (RARA) gene in a small subset of acute promyelocytic leukemias (APLL). The dysregulation of the signaling pathways mediated by this protein may be the cause of the APLL. [provided by RefSeq]
Product Categories/Family for anti-STAT5B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
90kDa
NCBI Official Full Name
signal transducer and activator of transcription 5B
NCBI Official Synonym Full Names
signal transducer and activator of transcription 5B
NCBI Official Symbol
STAT5B
NCBI Official Synonym Symbols
STAT5
NCBI Protein Information
signal transducer and activator of transcription 5B
UniProt Protein Name
Signal transducer and activator of transcription 5B
UniProt Gene Name
STAT5B
UniProt Entry Name
STA5B_HUMAN

NCBI Description

The protein encoded by this gene is a member of the STAT family of transcription factors. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein mediates the signal transduction triggered by various cell ligands, such as IL2, IL4, CSF1, and different growth hormones. It has been shown to be involved in diverse biological processes, such as TCR signaling, apoptosis, adult mammary gland development, and sexual dimorphism of liver gene expression. This gene was found to fuse to retinoic acid receptor-alpha (RARA) gene in a small subset of acute promyelocytic leukemias (APLL). The dysregulation of the signaling pathways mediated by this protein may be the cause of the APLL. [provided by RefSeq, Jul 2008]

Uniprot Description

STAT5B: transcription factor of the STAT family. Phosphorylated and activated by receptor-associated kinases triggered by cytokines including IL2, IL3, GM-CSF, and various growth hormones. It has been shown to be involved in diverse biological processes, such as TCR signaling, apoptosis, adult mammary gland development, and sexual dimorphism of liver gene expression. Forms homo- or heterodimers that translocate into the nucleus where they regulate transcription.

Protein type: DNA-binding; Oncoprotein; Transcription factor

Chromosomal Location of Human Ortholog: 17q11.2

Cellular Component: nucleoplasm; cytoplasm; cytosol; nucleus

Molecular Function: protein dimerization activity; protein binding; signal transducer activity; double-stranded DNA binding; chromatin binding; transcription factor activity; protein phosphatase binding; glucocorticoid receptor binding

Biological Process: positive regulation of interleukin-2 biosynthetic process; T cell differentiation in the thymus; response to lipopolysaccharide; positive regulation of multicellular organism growth; female pregnancy; 2-oxoglutarate metabolic process; sequestering of lipid; natural killer cell differentiation; allantoin metabolic process; regulation of steroid metabolic process; acute-phase response; T cell homeostasis; Peyer's patch development; isoleucine metabolic process; positive regulation of natural killer cell proliferation; valine metabolic process; development of secondary female sexual characteristics; JAK-STAT cascade; regulation of transcription from RNA polymerase II promoter; response to ethanol; regulation of epithelial cell differentiation; positive regulation of transcription from RNA polymerase II promoter; taurine metabolic process; negative regulation of apoptosis; transcription from RNA polymerase II promoter; lactation; succinate metabolic process; oxaloacetate metabolic process; positive regulation of smooth muscle cell proliferation; progesterone metabolic process; positive regulation of activated T cell proliferation; positive regulation of mitotic cell cycle; fatty acid metabolic process; response to estradiol stimulus; positive regulation of natural killer cell differentiation; luteinization; development of secondary male sexual characteristics; creatinine metabolic process; positive regulation of gamma-delta T cell differentiation; negative regulation of erythrocyte differentiation; regulation of multicellular organism growth; citrate metabolic process; positive regulation of cell motility; positive regulation of natural killer cell mediated cytotoxicity; liver development; creatine metabolic process; cellular response to hormone stimulus; response to hypoxia; positive regulation of B cell differentiation; positive regulation of inflammatory response

Disease: Growth Hormone Insensitivity With Immunodeficiency

Research Articles on STAT5B

Similar Products

Product Notes

The STAT5B stat5b (Catalog #AAA6171193) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's STAT5B can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the STAT5B stat5b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "STAT5B, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.