Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.33kD).)

Mouse anti-Human, Mouse STAG2 Monoclonal Antibody | anti-STAG2 antibody

STAG2 (Stromal Antigen 2, SA2, SA-2, Cohesin Subunit SA-2, SCC3 Homolog 2, SCC3B, bA517O1.1) (HRP)

Gene Names
STAG2; SA2; SA-2; SCC3B; bA517O1.1
Reactivity
Human, Mouse
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
STAG2; Monoclonal Antibody; STAG2 (Stromal Antigen 2; SA2; SA-2; Cohesin Subunit SA-2; SCC3 Homolog 2; SCC3B; bA517O1.1) (HRP); anti-STAG2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3C6
Specificity
Recognizes human STAG2. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-STAG2 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1130-1231 from human STAG2 (NP_006594) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KRLRPEDSFMSVYPMQTEHHQTPLDYNRRGTSLMEDDEEPIVEDVMMSSEGRIEDLNEGMDFDTMDIDLPPSKNRRERTELKPDFFDPASIMDESVLGVSMF
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.33kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.33kD).)

Western Blot (WB)

(STAG2 monoclonal antibody Western Blot analysis of STAG2 expression in Hela NE.)

Western Blot (WB) (STAG2 monoclonal antibody Western Blot analysis of STAG2 expression in Hela NE.)

Western Blot (WB)

(STAG2 monoclonal antibody Western Blot analysis of STAG2 expression in NIH/3T3.)

Western Blot (WB) (STAG2 monoclonal antibody Western Blot analysis of STAG2 expression in NIH/3T3.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to STAG2 on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 3ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to STAG2 on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 3ug/ml].)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to STAG2 on HeLa cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to STAG2 on HeLa cell. [antibody concentration 10ug/ml].)
Product Categories/Family for anti-STAG2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
145,751 Da
NCBI Official Full Name
cohesin subunit SA-2 isoform b
NCBI Official Synonym Full Names
stromal antigen 2
NCBI Official Symbol
STAG2
NCBI Official Synonym Symbols
SA2; SA-2; SCC3B; bA517O1.1
NCBI Protein Information
cohesin subunit SA-2; SCC3 homolog 2
UniProt Protein Name
Cohesin subunit SA-2
Protein Family
UniProt Gene Name
STAG2
UniProt Synonym Gene Names
SA2
UniProt Entry Name
STAG2_HUMAN

NCBI Description

The protein encoded by this gene is a subunit of the cohesin complex, which regulates the separation of sister chromatids during cell division. Targeted inactivation of this gene results in chromatid cohesion defects and aneuploidy, suggesting that genetic disruption of cohesin is a cause of aneuploidy in human cancer. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2013]

Uniprot Description

STAG2: Component of cohesin complex, a complex required for the cohesion of sister chromatids after DNA replication. The cohesin complex apparently forms a large proteinaceous ring within which sister chromatids can be trapped. At anaphase, the complex is cleaved and dissociates from chromatin, allowing sister chromatids to segregate. The cohesin complex may also play a role in spindle pole assembly during mitosis. Interacts directly with RAD21 in cohesin complex. Cohesin complexes are composed of a heterodimer between a SMC1 protein (SMC1A or SMC1B) and SMC3, which are attached via their hinge domain, and RAD21 which link them at their heads, and one STAG protein (STAG1, STAG2 or STAG3). In cohesin complexes, STAG2 is mutually exclusive with STAG1 and STAG3. Belongs to the SCC3 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription, coactivator/corepressor

Chromosomal Location of Human Ortholog: Xq25

Cellular Component: nucleoplasm; intermediate filament cytoskeleton; membrane; plasma membrane; nucleolus; chromosome; chromatin; nucleus; cytosol; chromosome, pericentric region; actin cytoskeleton

Molecular Function: protein binding; chromatin binding

Biological Process: mitosis; meiotic cell cycle; cell division; stem cell maintenance; sister chromatid cohesion; negative regulation of DNA endoreduplication; mitotic cell cycle

Research Articles on STAG2

Similar Products

Product Notes

The STAG2 stag2 (Catalog #AAA6155220) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The STAG2 (Stromal Antigen 2, SA2, SA-2, Cohesin Subunit SA-2, SCC3 Homolog 2, SCC3B, bA517O1.1) (HRP) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's STAG2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the STAG2 stag2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "STAG2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.