Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Mouse anti-Human Stabilin 1 Monoclonal Antibody | anti-STAB1 antibody

Stabilin 1 (Stabilin-1, STAB1, STAB-1, Fasciclin, EGF-like, Laminin-type EGF-like and Link Domain-containing Scavenger Receptor 1, FEEL1, FEEL-1, FELE-1, CLEVER-1, FEX1, KIAA0246, MS-1 Antigen) (HRP)

Gene Names
STAB1; FEX1; FEEL-1; FELE-1; SCARH2; STAB-1; CLEVER-1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Stabilin 1; Monoclonal Antibody; Stabilin 1 (Stabilin-1; STAB1; STAB-1; Fasciclin; EGF-like; Laminin-type EGF-like and Link Domain-containing Scavenger Receptor 1; FEEL1; FEEL-1; FELE-1; CLEVER-1; FEX1; KIAA0246; MS-1 Antigen) (HRP); anti-STAB1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4G9
Specificity
Recognizes human STAB1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Sequence Length
7928
Applicable Applications for anti-STAB1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1804-1903 from STAB1 (NP_055951) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
EALASDLPNLGPLRTMHGTPISFSCSRTRAGELMVGEDDARIVQRHLPFEGGLAYGIDQLLEPPGLGARCDHFETRPLRLNTCSICGLEPPCPEGSQEQ*
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Testing Data

(Detection limit for recombinant GST tagged STAB1 is 0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged STAB1 is 0.03ng/ml as a capture antibody.)
Product Categories/Family for anti-STAB1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens stabilin 1 (STAB1), mRNA
NCBI Official Synonym Full Names
stabilin 1
NCBI Official Symbol
STAB1
NCBI Official Synonym Symbols
FEX1; FEEL-1; FELE-1; SCARH2; STAB-1; CLEVER-1
NCBI Protein Information
stabilin-1
UniProt Protein Name
Stabilin-1
Protein Family
UniProt Gene Name
STAB1
UniProt Synonym Gene Names
FEEL1; KIAA0246; FEEL-1

NCBI Description

This gene encodes a large, transmembrane receptor protein which may function in angiogenesis, lymphocyte homing, cell adhesion, or receptor scavenging. The protein contains 7 fasciclin, 16 epidermal growth factor (EGF)-like, and 2 laminin-type EGF-like domains as well as a C-type lectin-like hyaluronan-binding Link module. The protein is primarily expressed on sinusoidal endothelial cells of liver, spleen, and lymph node. The receptor has been shown to endocytose ligands such as low density lipoprotein, Gram-positive and Gram-negative bacteria, and advanced glycosylation end products. Supporting its possible role as a scavenger receptor, the protein rapidly cycles between the plasma membrane and early endosomes. [provided by RefSeq, Jul 2008]

Uniprot Description

STAB1: Acts as a scavenger receptor for acetylated low density lipoprotein. Binds to both Gram-positive and Gram-negative bacteria and may play a role in defense against bacterial infection. When inhibited in endothelial tube formation assays, there is a marked decrease in cell-cell interactions, suggesting a role in angiogenesis. Involved in the delivery of newly synthesized CHID1/SI-CLP from the biosynthetic compartment to the endosomal/lysosomal system. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Receptor, misc.

Chromosomal Location of Human Ortholog: 3p21.1

Cellular Component: integral to plasma membrane; plasma membrane

Molecular Function: low-density lipoprotein binding; low-density lipoprotein receptor activity; protein binding; scavenger receptor activity

Biological Process: cell-cell signaling; defense response to bacterium; negative regulation of angiogenesis; receptor-mediated endocytosis

Research Articles on STAB1

Similar Products

Product Notes

The STAB1 stab1 (Catalog #AAA6155217) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Stabilin 1 (Stabilin-1, STAB1, STAB-1, Fasciclin, EGF-like, Laminin-type EGF-like and Link Domain-containing Scavenger Receptor 1, FEEL1, FEEL-1, FELE-1, CLEVER-1, FEX1, KIAA0246, MS-1 Antigen) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Stabilin 1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the STAB1 stab1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Stabilin 1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.