Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human SSX3 Monoclonal Antibody | anti-SSX3 antibody

SSX3 (Protein SSX3, Cancer/testis Antigen 5.3, CT5.3) (HRP)

Gene Names
SSX3; CT5.3
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SSX3; Monoclonal Antibody; SSX3 (Protein SSX3; Cancer/testis Antigen 5.3; CT5.3) (HRP); anti-SSX3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4A11
Specificity
Recognizes human SSX3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Sequence Length
1270
Applicable Applications for anti-SSX3 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-100 from SSX3 (NP_066294) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MNGDDTFARRPTVGAQIPEKIQKAFDDIAKYFSKEEWEKMKVSEKIVYVYMKRKYEAMTKLGFKAILPSFMRNKRVTDFQGNDFDNDPNRGNQVQRPQMT
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB)

(Western Blot analysis of SSX3 expression in transfected 293T cell line by SSX3 monoclonal antibody Lane 1: SSX3 transfected lysate (21.697kD). Lane 2: Non-transfected lysate)

Western Blot (WB) (Western Blot analysis of SSX3 expression in transfected 293T cell line by SSX3 monoclonal antibody Lane 1: SSX3 transfected lysate (21.697kD). Lane 2: Non-transfected lysate)

Testing Data

(Detection limit for recombinant GST tagged SSX3 is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SSX3 is 0.3ng/ml as a capture antibody.)
Product Categories/Family for anti-SSX3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens SSX family member 3 (SSX3), mRNA
NCBI Official Synonym Full Names
SSX family member 3
NCBI Official Symbol
SSX3
NCBI Official Synonym Symbols
CT5.3
NCBI Protein Information
protein SSX3
UniProt Protein Name
Protein SSX3
Protein Family
UniProt Gene Name
SSX3
UniProt Synonym Gene Names
CT5.3

NCBI Description

The product of this gene belongs to the family of highly homologous synovial sarcoma X (SSX) breakpoint proteins. These proteins may function as transcriptional repressors. They are also capable of eliciting spontaneous humoral and cellular immune responses in cancer patients, and are potentially useful targets in cancer vaccine-based immunotherapy. While some of the related SSX genes are involved in t(X;18)(p11.2;q11.2) translocations that are characteristically found in all synovial sarcomas, this gene does not appear to be involved in such translocations. [provided by RefSeq, Jul 2013]

Uniprot Description

SSX3: Could act as a modulator of transcription. Belongs to the SSX family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cancer Testis Antigen (CTA)

Chromosomal Location of Human Ortholog: Xp11.23

Cellular Component: nucleus

Molecular Function: nucleic acid binding; protein binding; transcription corepressor activity

Biological Process: regulation of transcription, DNA-templated; transcription, DNA-dependent

Research Articles on SSX3

Similar Products

Product Notes

The SSX3 ssx3 (Catalog #AAA6155209) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SSX3 (Protein SSX3, Cancer/testis Antigen 5.3, CT5.3) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SSX3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SSX3 ssx3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SSX3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.