Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human SSR2 Monoclonal Antibody | anti-SSR2 antibody

SSR2 (TRAPB, Translocon-associated Protein Subunit beta, Signal Sequence Receptor Subunit beta, SSR-beta, DKFZp686F19123, HSD25) (FITC)

Gene Names
SSR2; TLAP; HSD25; TRAPB; TRAP-BETA
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SSR2; Monoclonal Antibody; SSR2 (TRAPB; Translocon-associated Protein Subunit beta; Signal Sequence Receptor Subunit beta; SSR-beta; DKFZp686F19123; HSD25) (FITC); anti-SSR2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4C1
Specificity
Recognizes human SSR2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-SSR2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa51-151 from human SSR2 (NP_003136) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SSAALDVELSDDSFPPEDFGIVSGMLNVKWDRIAPASNVSHTVVLRPLKAGYFNFTSATITYLAQEDGPVVIGSTSAPGQGGILAQREFDRRFSPHFLDW*
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB)

(Western Blot analysis of SSR2 expression in transfected 293T cell line by SSR2 monoclonal antibody. Lane 1: SSR2 transfected lysate (20.5kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of SSR2 expression in transfected 293T cell line by SSR2 monoclonal antibody. Lane 1: SSR2 transfected lysate (20.5kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged SSR2 is 1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SSR2 is 1ng/ml as a capture antibody.)
Related Product Information for anti-SSR2 antibody
The signal sequence receptor (SSR) is a glycosylated endoplasmic reticulum (ER) membrane receptor associated with protein translocation across the ER membrane. The SSR consists of 2 subunits, a 34kD glycoprotein (alpha-SSR or SSR1) and a 22kD glycoprotein (beta-SSR or SSR2). The human beta-signal sequence receptor gene (SSR2) maps to chromosome bands 1q21-q23. [provided by RefSeq].
Product Categories/Family for anti-SSR2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
20,135 Da
NCBI Official Full Name
translocon-associated protein subunit beta
NCBI Official Synonym Full Names
signal sequence receptor, beta (translocon-associated protein beta)
NCBI Official Symbol
SSR2
NCBI Official Synonym Symbols
TLAP; HSD25; TRAPB; TRAP-BETA
NCBI Protein Information
translocon-associated protein subunit beta; SSR-beta; signal sequence receptor subunit beta; translocon-associated protein beta
UniProt Protein Name
Translocon-associated protein subunit beta
Protein Family
UniProt Gene Name
SSR2
UniProt Synonym Gene Names
TRAPB; TRAP-beta; SSR-beta
UniProt Entry Name
SSRB_HUMAN

NCBI Description

The signal sequence receptor (SSR) is a glycosylated endoplasmic reticulum (ER) membrane receptor associated with protein translocation across the ER membrane. The SSR consists of 2 subunits, a 34-kD glycoprotein (alpha-SSR or SSR1) and a 22-kD glycoprotein (beta-SSR or SSR2). The human beta-signal sequence receptor gene (SSR2) maps to chromosome bands 1q21-q23. [provided by RefSeq, Jul 2008]

Uniprot Description

SSR2: TRAP proteins are part of a complex whose function is to bind calcium to the ER membrane and thereby regulate the retention of ER resident proteins. Belongs to the TRAP-beta family.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 1q21-q23

Cellular Component: endoplasmic reticulum membrane; endoplasmic reticulum; integral to membrane

Biological Process: SRP-dependent cotranslational protein targeting to membrane; cellular protein metabolic process; translation; gene expression; cotranslational protein targeting to membrane

Research Articles on SSR2

Similar Products

Product Notes

The SSR2 ssr2 (Catalog #AAA6149901) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SSR2 (TRAPB, Translocon-associated Protein Subunit beta, Signal Sequence Receptor Subunit beta, SSR-beta, DKFZp686F19123, HSD25) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SSR2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SSR2 ssr2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SSR2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.