Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human SRP54 Monoclonal Antibody | anti-SRP54 antibody

SRP54 (Signal Recognition Particle 54kD Protein) (Biotin)

Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SRP54; Monoclonal Antibody; SRP54 (Signal Recognition Particle 54kD Protein) (Biotin); anti-SRP54 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2G7
Specificity
Recognizes human SRP54.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-SRP54 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-101 from human SRP54 (NP_003127) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAIDLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGK*
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Testing Data

(Detection limit for recombinant GST tagged SRP54 is 0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SRP54 is 0.1ng/ml as a capture antibody.)
Related Product Information for anti-SRP54 antibody
Binds to the signal sequence of presecretory protein when they emerge from the ribosomes and transfers them to TRAM (translocating chain-associating membrane protein).
Product Categories/Family for anti-SRP54 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50,369 Da
NCBI Official Full Name
signal recognition particle 54 kDa protein isoform 1
NCBI Official Synonym Full Names
signal recognition particle 54kDa
NCBI Official Symbol
SRP54
NCBI Protein Information
signal recognition particle 54 kDa protein
UniProt Protein Name
Signal recognition particle 54 kDa protein
UniProt Gene Name
SRP54
UniProt Synonym Gene Names
SRP54
UniProt Entry Name
SRP54_HUMAN

Uniprot Description

SRP54: Binds to the signal sequence of presecretory protein when they emerge from the ribosomes and transfers them to TRAM (translocating chain-associating membrane protein). Belongs to the GTP-binding SRP family. SRP54 subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: RNA-binding

Chromosomal Location of Human Ortholog: 14q13.2

Cellular Component: cytoplasm; signal recognition particle, endoplasmic reticulum targeting; nucleolus; nuclear speck; nucleus; cytosol

Molecular Function: GTPase activity; ribonucleoprotein binding; GDP binding; GTP binding; drug binding; endoplasmic reticulum signal peptide binding; 7S RNA binding

Biological Process: response to drug; SRP-dependent cotranslational protein targeting to membrane, translocation; SRP-dependent cotranslational protein targeting to membrane; protein targeting to ER; cellular protein metabolic process; translation; SRP-dependent cotranslational protein targeting to membrane, signal sequence recognition; gene expression

Research Articles on SRP54

Similar Products

Product Notes

The SRP54 srp54 (Catalog #AAA6144585) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SRP54 (Signal Recognition Particle 54kD Protein) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SRP54 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SRP54 srp54 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SRP54, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.