Mouse SRF Monoclonal Antibody | anti-SRF antibody

SRF (Serum Response Factor (c-fos Serum Response Element-Binding Transcription Factor), MCM1) (HRP)

Cat. Num. AAA6182095

• Gene Names: SRF; MCM1
• Applications: ELISA, Western Blot
• Purity: Purified
• Synonyms: SRF; Monoclonal Antibody; SRF (Serum Response Factor (c-fos Serum Response Element-Binding Transcription Factor); MCM1) (HRP); Serum Response Factor (c-fos Serum Response Element-Binding Transcription Factor); MCM1; anti-SRF antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2C9
• Specificity: Recognizes SRF.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-SRF antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: SRF (NP_003122, 244aa-332aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: TDLTYQVSESDSSGETKDTLKPAFTVTNLPGTTSTIQTAPSTSTTMQVSSGPSFPITNYLAPVSASVSPSAVSSANGTVLKSTGSGPV
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(SRF monoclonal antibody (M04), clone 2C9. Western Blot analysis of SRF expression in Hela S3 NE (Cat # L013V3).)

Product Categories/Family for anti-SRF antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 4507205
• NCBI GeneID: 6722
• NCBI Accession #: NP_003122
• NCBI GenBank Nucleotide #: NM_003131
• UniProt Accession #: P11831; Q5T648
• Molecular Weight: 51,593 Da
• NCBI Official Full Name: serum response factor isoform 1
• NCBI Official Synonym Full Names: serum response factor (c-fos serum response element-binding transcription factor)
• NCBI Official Symbol: SRF
• NCBI Official Synonym Symbols: MCM1
• NCBI Protein Information: serum response factor
• UniProt Protein Name: Serum response factor
• Protein Family: Serum response factor
• UniProt Gene Name: SRF
• UniProt Synonym Gene Names: SRF
• UniProt Entry Name: SRF_HUMAN

Uniprot Description

SRF: a transcription factor of the MADS domain family that binds to the serum response element (SRE). Regulates the transcription of immediate early genes including c-fos. Binds DNA as a multimer, probably a dimer.

Protein type: Transcription factor; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 6p21.1

Cellular Component: nuclear chromatin; cytoplasm; nucleus

Molecular Function: RNA polymerase II transcription factor activity, enhancer binding; protein binding; protein homodimerization activity; chromatin DNA binding; transcription factor binding; transcription factor activity

Biological Process: transcription from RNA polymerase II promoter; developmental growth; erythrocyte development; positive regulation of transcription by glucose; cell-matrix adhesion; response to toxin; heart development; positive regulation of axon extension; response to hormone stimulus; neuron migration; cardiac myofibril assembly; muscle maintenance; negative regulation of cell proliferation; tangential migration from the subventricular zone to the olfactory bulb; regulation of smooth muscle cell differentiation; morphogenesis of an epithelial sheet; positive regulation of smooth muscle contraction; heart looping; negative regulation of cell migration; neurite development; associative learning; positive thymic T cell selection; positive regulation of filopodium formation; regulation of cell adhesion; platelet activation; skin morphogenesis; hippocampus development; sarcomere organization; angiogenesis involved in wound healing; mRNA transcription from RNA polymerase II promoter; trophectodermal cell differentiation; regulation of water loss via skin; patterning of blood vessels; contractile actin filament bundle formation; mesoderm formation; long-term memory; cell migration during sprouting angiogenesis; response to cytokine stimulus; stress fiber formation; response to hypoxia; neuron development; positive regulation of transcription from RNA polymerase II promoter; positive regulation of transcription factor activity; platelet formation; positive regulation of cell differentiation