Mouse anti-Human SREBF1 Monoclonal Antibody | anti-SREBF1 antibody

SREBF1 (Sterol Regulatory Element Binding Transcription Factor 1, SREBP-1c, SREBP1, bHLHd1) (MaxLight 405)

Cat. Num. AAA6198064

• Gene Names: SREBF1; SREBP1; bHLHd1
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified
• Synonyms: SREBF1; Monoclonal Antibody; SREBF1 (Sterol Regulatory Element Binding Transcription Factor 1; SREBP-1c; SREBP1; bHLHd1) (MaxLight 405); Sterol Regulatory Element Binding Transcription Factor 1; bHLHd1; anti-SREBF1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4G4
• Specificity: Recognizes human SREBF1.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
• Sequence Length: 1147

• Applicable Applications for anti-SREBF1 antibody: FLISA, Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant protein corresponding to aa801-900 of human SREBF1 (AAH57388) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: VTQLFREHLLERALNCVTQPNPSPGSADGDKEFSDALGYLQLLNSCSDAAGAPAYSFSISSSMATTTGVDPVAKWWASLTAVVIHWLRRDEEAAERLCPL
• Conjugate: MaxLight405
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of SREBF1 expression in HeLa using.)

Western Blot (WB)

(Western Blot detection against immunogen (36.63kD).)

Testing Data

(Detection limit for is ~0.03ng/ml as a capture antibody.)

Related Product Information for anti-SREBF1 antibody

This gene encodes a transcription factor that binds to the sterol regulatory element-1 (SRE1), which is a decamer flanking the low density lipoprotein receptor gene and some genes involved in sterol biosynthesis. The protein is synthesized as a precursor that is attached to the nuclear membrane and endoplasmic reticulum. Following cleavage, the mature protein translocates to the nucleus and activates transcription by binding to the SRE1. Sterols inhibit the cleavage of the precursor, and the mature nuclear form is rapidly catabolized, thereby reducing transcription. The protein is a member of the basic helix-loop-helix-leucine zipper (bHLH-Zip) transcription factor family. This gene is located within the Smith-Magenis syndrome region on chromosome 17. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Product Categories/Family for anti-SREBF1 antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 34785767
• NCBI GeneID: 6720
• NCBI Official Full Name: Sterol regulatory element binding transcription factor 1
• NCBI Official Synonym Full Names: sterol regulatory element binding transcription factor 1
• NCBI Official Symbol: SREBF1
• NCBI Official Synonym Symbols: SREBP1; bHLHd1
• NCBI Protein Information: sterol regulatory element-binding protein 1

NCBI Description

This gene encodes a basic helix-loop-helix-leucine zipper (bHLH-Zip) transcription factor that binds to the sterol regulatory element-1 (SRE1), which is a motif that is found in the promoter of the low density lipoprotein receptor gene and other genes involved in sterol biosynthesis. The encoded protein is synthesized as a precursor that is initially attached to the nuclear membrane and endoplasmic reticulum. Following cleavage, the mature protein translocates to the nucleus and activates transcription. This cleaveage is inhibited by sterols. This gene is located within the Smith-Magenis syndrome region on chromosome 17. Alternative promoter usage and splicing result in multiple transcript variants, including SREBP-1a and SREBP-1c, which correspond to RefSeq transcript variants 2 and 3, respectively. [provided by RefSeq, Nov 2017]