Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (35.9kD).)

Mouse anti-Human SRC Monoclonal Antibody | anti-SRC antibody

SRC (Proto-oncogene Tyrosine-protein Kinase Src, Proto-oncogene c-Src, pp60c-src, p60-Src, SRC1) (AP)

Gene Names
SRC; ASV; SRC1; THC6; c-SRC; p60-Src
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SRC; Monoclonal Antibody; SRC (Proto-oncogene Tyrosine-protein Kinase Src; Proto-oncogene c-Src; pp60c-src; p60-Src; SRC1) (AP); anti-SRC antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1B9
Specificity
Recognizes human SRC.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-SRC antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-90 from human SRC (AAH11566) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPASADGHRGPSAAFAPAAAEPKLFGGFNSSDTVTSPQRAGPLAGGVTTFV
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.9kD).)

Western Blot (WB) (Western Blot detection against Immunogen (35.9kD).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to SRC on formalin-fixed paraffin-embedded human liver. [antibody concentration 3ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to SRC on formalin-fixed paraffin-embedded human liver. [antibody concentration 3ug/ml].)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between PTK2 and SRC HeLa cells were stained with PTK2 rabbit purified polyclonal 1:1200 and SRC mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between PTK2 and SRC HeLa cells were stained with PTK2 rabbit purified polyclonal 1:1200 and SRC mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)
Product Categories/Family for anti-SRC antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
60,589 Da
NCBI Official Full Name
Homo sapiens v-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian), mRNA
NCBI Official Synonym Full Names
SRC proto-oncogene, non-receptor tyrosine kinase
NCBI Official Symbol
SRC
NCBI Official Synonym Symbols
ASV; SRC1; THC6; c-SRC; p60-Src
NCBI Protein Information
proto-oncogene tyrosine-protein kinase Src
Protein Family

NCBI Description

This gene is highly similar to the v-src gene of Rous sarcoma virus. This proto-oncogene may play a role in the regulation of embryonic development and cell growth. The protein encoded by this gene is a tyrosine-protein kinase whose activity can be inhibited by phosphorylation by c-SRC kinase. Mutations in this gene could be involved in the malignant progression of colon cancer. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]

Research Articles on SRC

Similar Products

Product Notes

The SRC (Catalog #AAA6133971) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SRC (Proto-oncogene Tyrosine-protein Kinase Src, Proto-oncogene c-Src, pp60c-src, p60-Src, SRC1) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SRC can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SRC for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SRC, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.