Mouse anti-Human SPSB2 Monoclonal Antibody | anti-SPSB2 antibody

SPSB2 (SPRY Domain-containing SOCS Box Protein 2, SSB2, SSB-2, Gene-rich Cluster Protein C9, GRCC9) APC

Cat. Num. AAA6139270

• Gene Names: SPSB2; SSB2; GRCC9
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: SPSB2; Monoclonal Antibody; SPSB2 (SPRY Domain-containing SOCS Box Protein 2; SSB2; SSB-2; Gene-rich Cluster Protein C9; GRCC9) APC; FLJ17395; MGC2519; anti-SPSB2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1E6
• Specificity: Recognizes human GRCC9.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

• Applicable Applications for anti-SPSB2 antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1-91 from human GRCC9 (AAH02983) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MGQTALAGGSSSTPTPQALYPDLSCPEGLEELLSAPPPDLGAQRRHGWNPKDCSENIEVKEGGLYFERRPVAQSTDGARGKRGYSRGLHA
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.01kD).)

Western Blot (WB)

(GRCC9 monoclonal antibody, Western Blot analysis of SPSB2 expression in A-549.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to SPSB2 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged SPSB2 is ~0.03ng/ml as a capture antibody.)

Product Categories/Family for anti-SPSB2 antibody

Antibodies; SOCS

NCBI and Uniprot Product Information

• NCBI GI #: 12804248
• NCBI GeneID: 84727
• Molecular Weight: 28,642 Da
• NCBI Official Full Name: Homo sapiens splA/ryanodine receptor domain and SOCS box containing 2, mRNA
• NCBI Official Synonym Full Names: splA/ryanodine receptor domain and SOCS box containing 2
• NCBI Official Symbol: SPSB2
• NCBI Official Synonym Symbols: SSB2; GRCC9
• NCBI Protein Information: SPRY domain-containing SOCS box protein 2
• Protein Family: SPRY domain-containing SOCS box protein

NCBI Description

This gene encodes a member of a subfamily of proteins containing a central SPRY (repeats in splA and RyR) domain and a C-terminal suppressor of cytokine signaling (SOCS) box. This protein plays a role in cell signaling. This gene is present in a gene-rich cluster on chromosome 12p13 in the vicinity of the CD4 antigen and triosephosphate isomerase genes. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2016]