Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of SPRR4 expression in transfected 293T cell line by SPRR4 monoclonal antibody (M04), clone 1G5.Lane 1: SPRR4 transfected lysate (Predicted MW: 8.80000000 KDa).Lane 2: Non-transfected lysate.)

Mouse SPRR4 Monoclonal Antibody | anti-SPRR4 antibody

SPRR4 (Small Proline-Rich Protein 4, MGC138375, MGC138377) (PE)

Applications
Western Blot
Purity
Purified
Synonyms
SPRR4; Monoclonal Antibody; SPRR4 (Small Proline-Rich Protein 4; MGC138375; MGC138377) (PE); Small Proline-Rich Protein 4; MGC138377; anti-SPRR4 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1G5
Specificity
Recognizes SPRR4.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-SPRR4 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
SPRR4 (NP_775103.1, 1aa-79aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MSSQQQQRQQQQCPPQRAQQQQVKQPCQPPPVKCQETCAPKTKDPCAPQVKKQCPPKGTIIPAQQKCPSAQQASKSKQK
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of SPRR4 expression in transfected 293T cell line by SPRR4 monoclonal antibody (M04), clone 1G5.Lane 1: SPRR4 transfected lysate (Predicted MW: 8.80000000 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of SPRR4 expression in transfected 293T cell line by SPRR4 monoclonal antibody (M04), clone 1G5.Lane 1: SPRR4 transfected lysate (Predicted MW: 8.80000000 KDa).Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged SPRR4 is 0.03 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SPRR4 is 0.03 ng/ml as a capture antibody.)
Related Product Information for anti-SPRR4 antibody
Mouse monoclonal antibody raised against a full-length recombinant SPRR4.
Product Categories/Family for anti-SPRR4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
8,793 Da
NCBI Official Full Name
small proline-rich protein 4
NCBI Official Synonym Full Names
small proline-rich protein 4
NCBI Official Symbol
SPRR4
NCBI Protein Information
small proline-rich protein 4; small proline rich protein 4
UniProt Protein Name
Small proline-rich protein 4
UniProt Gene Name
SPRR4
UniProt Entry Name
SPRR4_HUMAN

Similar Products

Product Notes

The SPRR4 sprr4 (Catalog #AAA6187520) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's SPRR4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SPRR4 sprr4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SPRR4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.