Mouse anti-Human SPRR2F Monoclonal Antibody | anti-SPRR2F antibody

SPRR2F (Small Proline-rich Protein 2F, SPR-2F) APC

Cat. Num. AAA6139264

• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: SPRR2F; Monoclonal Antibody; SPRR2F (Small Proline-rich Protein 2F; SPR-2F) APC; anti-SPRR2F antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 5A9
• Specificity: Recognizes human SPRR2F.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

• Applicable Applications for anti-SPRR2F antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full-length recombinant corresponding to aa1-72 from human SPRR2F (NP_001014450) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MSYQQQQCKQPCQPPPVCPAPKCPEPCPPPKCPEPCPPSKCPQSCPPQQCQQKCPPVTPSPPCQPKCPPKSK
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (34.8kD).)

Western Blot (WB)

(Western Blot analysis of SPRR2F expression in transfected 293T cell line by SPRR2F monoclonal antibody. Lane 1: SPRR2F transfected lysate (7.8kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged SPRR2F is 0.1ng/ml as a capture antibody.)

Related Product Information for anti-SPRR2F antibody

Cross-linked envelope protein of keratinocytes. It is a keratinocyte protein that first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase. All that results in the formation of an insoluble envelope beneath the plasma membrane.

Product Categories/Family for anti-SPRR2F antibody

Antibodies; Proline-rich Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 62945419
• NCBI GeneID: 6705
• NCBI Accession #: NP_001014450.1
• NCBI GenBank Nucleotide #: NM_001014450
• UniProt Accession #: Q96RM1; Q5T9T3
• Molecular Weight: 7,805 Da
• NCBI Official Full Name: small proline-rich protein 2F
• NCBI Official Synonym Full Names: small proline-rich protein 2F
• NCBI Official Symbol: SPRR2F
• NCBI Protein Information: small proline-rich protein 2F; SPR-2F
• UniProt Protein Name: Small proline-rich protein 2F
• Protein Family: Small proline-rich protein
• UniProt Gene Name: SPRR2F
• UniProt Synonym Gene Names: SPR-2F
• UniProt Entry Name: SPR2F_HUMAN

Uniprot Description

Function: Cross-linked envelope protein of keratinocytes. It is a keratinocyte protein that first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase. All that results in the formation of an insoluble envelope beneath the plasma membrane

By similarity.

Subcellular location: Cytoplasm

By similarity.

Induction: During squamous differentiation of epidermal keratinocytes

By similarity.

Sequence similarities: Belongs to the cornifin (SPRR) family.