Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (38.21kD).)

Mouse anti-Human SPAG4 Monoclonal Antibody | anti-SPAG4 antibody

SPAG4 (Sperm-associated Antigen 4 Protein, Outer Dense Fiber-associated Protein SPAG4, SUN Domain-containing Protein 4, SUN4)

Gene Names
SPAG4; SUN4; CT127
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
SPAG4; Monoclonal Antibody; SPAG4 (Sperm-associated Antigen 4 Protein; Outer Dense Fiber-associated Protein SPAG4; SUN Domain-containing Protein 4; SUN4); Anti -SPAG4 (Sperm-associated Antigen 4 Protein; anti-SPAG4 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3C8
Specificity
Recognizes human SPAG4.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
AELDKLHKEVSTVRAANSERVAKLVFQRLNEDFVRKPDYALSSVGASIDLQKTSHDYADRNTAYFWNRFSFWNYARPPTVILEPHVFPGNCWAFEGDQGQVVIQLPGRVQ*
Applicable Applications for anti-SPAG4 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Partial recombinant corresponding to aa221-331 from human SPAG4 (NP_003107) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.21kD).)

Western Blot (WB) (Western Blot detection against Immunogen (38.21kD).)

Testing Data

(Detection limit for recombinant GST tagged SPAG4 is 1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SPAG4 is 1ng/ml as a capture antibody.)
Related Product Information for anti-SPAG4 antibody
May assist the organization and assembly of outer dense fibers (ODFs), a specific structure of the sperm tail.
Product Categories/Family for anti-SPAG4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48,165 Da
NCBI Official Full Name
sperm-associated antigen 4 protein
NCBI Official Synonym Full Names
sperm associated antigen 4
NCBI Official Symbol
SPAG4
NCBI Official Synonym Symbols
SUN4; CT127
NCBI Protein Information
sperm-associated antigen 4 protein; sperm tail protein; acrosomal protein ACR55; cancer/testis antigen 127; SUN domain-containing protein 4; Sad1 and UNC84 domain containing 4; outer dense fiber-associated protein SPAG4
UniProt Protein Name
Sperm-associated antigen 4 protein
UniProt Gene Name
SPAG4
UniProt Synonym Gene Names
SUN4
UniProt Entry Name
SPAG4_HUMAN

NCBI Description

The mammalian sperm flagellum contains two cytoskeletal structures associated with the axoneme: the outer dense fibers surrounding the axoneme in the midpiece and principal piece and the fibrous sheath surrounding the outer dense fibers in the principal piece of the tail. Defects in these structures are associated with abnormal tail morphology, reduced sperm motility, and infertility. In the rat, the protein encoded by this gene associates with an outer dense fiber protein via a leucine zipper motif and localizes to the microtubules of the manchette and axoneme during sperm tail development. [provided by RefSeq, Jul 2008]

Uniprot Description

SPAG4: May assist the organization and assembly of outer dense fibers (ODFs), a specific structure of the sperm tail.

Protein type: Membrane protein, integral; Microtubule-binding; Cancer Testis Antigen (CTA); Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 20q11.21

Cellular Component: cytoskeleton; cytoplasm; integral to membrane; nuclear envelope

Molecular Function: structural molecule activity

Biological Process: spermatogenesis; nuclear membrane organization and biogenesis

Similar Products

Product Notes

The SPAG4 spag4 (Catalog #AAA6011199) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SPAG4 (Sperm-associated Antigen 4 Protein, Outer Dense Fiber-associated Protein SPAG4, SUN Domain-containing Protein 4, SUN4) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SPAG4 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the SPAG4 spag4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: AELDKLHKEV STVRAANSER VAKLVFQRLN EDFVRKPDYA LSSVGASIDL QKTSHDYADR NTAYFWNRFS FWNYARPPTV ILEPHVFPGN CWAFEGDQGQ VVIQLPGRVQ *. It is sometimes possible for the material contained within the vial of "SPAG4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.