Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human SPA17 Monoclonal Antibody | anti-SPA17 antibody

SPA17 (Sperm Autoantigenic Protein 17, Sperm Protein 17, SP17, Sp17-1, Sperm Surface Protein Sp17, Cancer/testis Antigen 22, CT22) (MaxLight 650)

Gene Names
SPA17; CT22; SP17; SP17-1
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography
Synonyms
SPA17; Monoclonal Antibody; SPA17 (Sperm Autoantigenic Protein 17; Sperm Protein 17; SP17; Sp17-1; Sperm Surface Protein Sp17; Cancer/testis Antigen 22; CT22) (MaxLight 650); anti-SPA17 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3B6
Specificity
Recognizes human SPA17.
Purity/Purification
Purified by Protein A Affinity Chromatography
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Applicable Applications for anti-SPA17 antibody
FLISA, Western Blot (WB)
Application Notes
WB: Transfected 293T cells and recombinant protein
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa51-149 from human SPA17 with GST tag (NP_059121). MW of the GST tag alone is 26kD.
Immunogen Sequence
EKTNFDPAEWGSKVEDRFYNNHAFEEQEPPEKSDPKQEESQISGKEEETSVTILDSSEEDKEKEEVAAVKIQAAFRGHIAREEAKKMKTNSLQNEEKEE
Conjugate
MaxLight650
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Product Categories/Family for anti-SPA17 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
19.8 kDa (174aa) confirmed by MALDI-TOF (Molecular size on SDS-PAGE will appear higher)
NCBI Official Full Name
sperm surface protein Sp17
NCBI Official Synonym Full Names
sperm autoantigenic protein 17
NCBI Official Symbol
SPA17
NCBI Official Synonym Symbols
CT22; SP17; SP17-1
NCBI Protein Information
sperm surface protein Sp17
UniProt Protein Name
Sperm surface protein Sp17
Protein Family
UniProt Gene Name
SPA17
UniProt Synonym Gene Names
SP17; CT22
UniProt Entry Name
SP17_HUMAN

NCBI Description

This gene encodes a protein present at the cell surface. The N-terminus has sequence similarity to human cAMP-dependent protein kinase A (PKA) type II alpha regulatory subunit (RIIa) while the C-terminus has an IQ calmodulin-binding motif. The central portion of the protein has carbohydrate binding motifs and likely functions in cell-cell adhesion. The protein was initially characterized by its involvement in the binding of sperm to the zona pellucida of the oocyte. Recent studies indicate that it is also involved in additional cell-cell adhesion functions such as immune cell migration and metastasis. A retrotransposed pseudogene is present on chromosome 10q22.[provided by RefSeq, Jan 2009]

Uniprot Description

SPA17: Sperm surface zona pellucida binding protein. Helps to bind spermatozoa to the zona pellucida with high affinity. Might function in binding zona pellucida and carbohydrates.

Protein type: Cancer Testis Antigen (CTA)

Chromosomal Location of Human Ortholog: 11q24.2

Cellular Component: membrane; cytoplasm

Molecular Function: calmodulin binding

Biological Process: binding of sperm to zona pellucida; single fertilization; spermatogenesis

Research Articles on SPA17

Similar Products

Product Notes

The SPA17 spa17 (Catalog #AAA6224830) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SPA17 (Sperm Autoantigenic Protein 17, Sperm Protein 17, SP17, Sp17-1, Sperm Surface Protein Sp17, Cancer/testis Antigen 22, CT22) (MaxLight 650) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SPA17 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). WB: Transfected 293T cells and recombinant protein Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SPA17 spa17 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SPA17, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.