Mouse SP3 Monoclonal Antibody | anti-SP3 antibody

SP3 (Sp3 Transcription Factor, DKFZp686O1631, SPR-2) (APC)

Cat. Num. AAA6166982

• Gene Names: SP3; SPR2
• Applications: ELISA, Western Blot
• Purity: Purified
• Synonyms: SP3; Monoclonal Antibody; SP3 (Sp3 Transcription Factor; DKFZp686O1631; SPR-2) (APC); Sp3 Transcription Factor; SPR-2; anti-SP3 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2F6
• Specificity: Recognizes SP3.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

• Applicable Applications for anti-SP3 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: SP3 (NP_003102, 287aa-430aa) full length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: TAGINADGHLINTGQAMDSSDNSERTGERVSPDINETNTDTDLFVPTSSSSQLPVTIDSTGILQQNTNSLTTSSGQVHSSDLQGNYIQSPVSEETQAQNIQVSTAQPVVQHLQLQESQQPTSQAQIVQGITPQTIHGVQASGQN*
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(SP3 monoclonal antibody (M08), clone 2F6. Western Blot analysis of SP3 expression in human stomach.)

Related Product Information for anti-SP3 antibody

This gene belongs to a family of Sp1 related genes that encode transcription factors that regulate transcription by binding to consensus GC- and GT-box regulatory elements in target genes. This protein contains a zinc finger DNA-binding domain and several transactivation domains, and has been reported to function as a bifunctional transcription factor that either stimulates or represses the transcription of numerous genes. Transcript variants encoding different isoforms have been described for this gene, and one has been reported to initiate translation from a non-AUG (AUA) start codon. Additional isoforms, resulting from the use of alternate downstream translation initiation sites, have also been noted. [provided by RefSeq]

Product Categories/Family for anti-SP3 antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 289577125
• NCBI GeneID: 6670
• NCBI Accession #: NP_003102
• NCBI GenBank Nucleotide #: NM_003111
• UniProt Accession #: Q02447
• Molecular Weight: 82kDa
• NCBI Official Full Name: transcription factor Sp3 isoform 2
• NCBI Official Synonym Full Names: Sp3 transcription factor
• NCBI Official Symbol: SP3
• NCBI Official Synonym Symbols: SPR2
• NCBI Protein Information: transcription factor Sp3
• UniProt Protein Name: Transcription factor Sp3
• Protein Family: Transcription factor
• UniProt Gene Name: SP3
• UniProt Entry Name: SP3_HUMAN

NCBI Description

This gene belongs to a family of Sp1 related genes that encode transcription factors that regulate transcription by binding to consensus GC- and GT-box regulatory elements in target genes. This protein contains a zinc finger DNA-binding domain and several transactivation domains, and has been reported to function as a bifunctional transcription factor that either stimulates or represses the transcription of numerous genes. Transcript variants encoding different isoforms have been described for this gene, and one has been reported to initiate translation from a non-AUG (AUA) start codon. Additional isoforms, resulting from the use of alternate downstream translation initiation sites, have also been noted. A related pseudogene has been identified on chromosome 13. [provided by RefSeq, Feb 2010]

Uniprot Description

Transcriptional factor that can act as an activator or repressor depending on isoform and/or post-translational modifications. Binds to GT and GC boxes promoter elements. Competes with SP1 for the GC-box promoters. Weak activator of transcription but can activate a number of genes involved in different processes such as cell-cycle regulation, hormone-induction and house-keeping.