Mouse SP110 Monoclonal Antibody | anti-SP110 antibody

SP110 (SP110 Nuclear body Protein, FLJ22835, IFI41, IFI75, IPR1, VODI) (FITC)

Cat. Num. AAA6176943

• Gene Names: SP110; IPR1; VODI; IFI41; IFI75
• Applications: Immunofluorescence, Western Blot
• Purity: Purified
• Synonyms: SP110; Monoclonal Antibody; SP110 (SP110 Nuclear body Protein; FLJ22835; IFI41; IFI75; IPR1; VODI) (FITC); SP110 Nuclear body Protein; VODI; anti-SP110 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2G10
• Specificity: Recognizes SP110.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-SP110 antibody: Immunofluorescence (IF), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: SP110 (NP_004501, 271aa-380aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: TPSDKKGKKRKRCIWSTPKRRHKKKSLPRGTASSRHGIQKKLKRVDQVPQKKDDSTCNSTVETRAQKARTECARKSRSEEIIDGTSEMNEGKRSQKTPSTPRRVTQGAAS
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.; ; FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(SP110 monoclonal antibody (M03), clone 2G10 Western Blot analysis of SP110 expression in Hela S3 NE (Cat # L013V3).)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to SP110 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to SP110 on HeLa cell. [antibody concentration 10 ug/ml])

Testing Data

(Detection limit for recombinant GST tagged SP110 is approximately 0.1ng/ml as a capture antibody.)

Related Product Information for anti-SP110 antibody

The nuclear body is a multiprotein complex that may have a role in the regulation of gene transcription. This gene is a member of the SP100/SP140 family of nuclear body proteins and encodes a leukocyte-specific nuclear body component. The protein can function as an activator of gene transcription and may serve as a nuclear hormone receptor coactivator. In addition, it has been suggested that the protein may play a role in ribosome biogenesis and in the induction of myeloid cell differentiation. Alternative splicing has been observed for this gene and three transcript variants, encoding distinct isoforms, have been identified. [provided by RefSeq]

Product Categories/Family for anti-SP110 antibody

Antibodies; Interferon

NCBI and Uniprot Product Information

• NCBI GI #: 190343008
• NCBI GeneID: 3431
• NCBI Accession #: NP_004501
• NCBI GenBank Nucleotide #: NM_004510.3
• UniProt Accession #: Q9HB58; Q14976; Q14977; Q53TG2; Q8WUZ6; Q9HCT8; B4DVI4; F5H1M1
• Molecular Weight: 62,603 Da
• NCBI Official Full Name: sp110 nuclear body protein isoform b
• NCBI Official Synonym Full Names: SP110 nuclear body protein
• NCBI Official Symbol: SP110
• NCBI Official Synonym Symbols: IPR1; VODI; IFI41; IFI75
• NCBI Protein Information: sp110 nuclear body protein; speckled 110 kDa; phosphoprotein 41; phosphoprotein 75; interferon-induced protein 41/75; transcriptional coactivator Sp110; interferon-induced protein 41, 30kD; interferon-induced protein 75, 52kD
• UniProt Protein Name: Sp110 nuclear body protein
• Protein Family: Sp110 nuclear body protein
• UniProt Gene Name: SP110
• UniProt Entry Name: SP110_HUMAN

NCBI Description

The nuclear body is a multiprotein complex that may have a role in the regulation of gene transcription. This gene is a member of the SP100/SP140 family of nuclear body proteins and encodes a leukocyte-specific nuclear body component. The protein can function as an activator of gene transcription and may serve as a nuclear hormone receptor coactivator. In addition, it has been suggested that the protein may play a role in ribosome biogenesis and in the induction of myeloid cell differentiation. Alternative splicing has been observed for this gene and three transcript variants, encoding distinct isoforms, have been identified. [provided by RefSeq, Jul 2008]

Uniprot Description

SP110: Transcription factor. May be a nuclear hormone receptor coactivator. Enhances transcription of genes with retinoic acid response elements (RARE). Defects in SP110 are the cause of hepatic venoocclusive disease with immunodeficiency (VODI). VODI is an autosomal recessive primary immunodeficiency associated with hepatic vascular occlusion and fibrosis. The immunodeficiency is characterized by severe hypogammaglobulinemia, combined T and B cell immunodeficiency, absent lymph node germinal centers, and absent tissue plasma cells. 6 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: 2q37.1

Cellular Component: nucleolus; nucleus

Molecular Function: signal transducer activity; DNA binding; zinc ion binding; chromatin binding

Biological Process: chromatin remodeling; transcription, DNA-dependent; viral reproduction; regulation of transcription, DNA-dependent; signal transduction

Disease: Mycobacterium Tuberculosis, Susceptibility To; Hepatic Venoocclusive Disease With Immunodeficiency