Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged SP110 is approximately 0.3ng/ml as a capture antibody.)

Mouse SP110 Monoclonal Antibody | anti-SP110 antibody

SP110 (SP110 Nuclear body Protein, FLJ22835, IFI41, IFI75, IPR1, VODI) (Biotin)

Gene Names
SP110; IPR1; VODI; IFI41; IFI75
Applications
Western Blot
Purity
Purified
Synonyms
SP110; Monoclonal Antibody; SP110 (SP110 Nuclear body Protein; FLJ22835; IFI41; IFI75; IPR1; VODI) (Biotin); SP110 Nuclear body Protein; VODI; anti-SP110 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4B8
Specificity
Recognizes SP110.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-SP110 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
SP110 (NP_004501, 271aa-380aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TPSDKKGKKRKRCIWSTPKRRHKKKSLPRGTASSRHGIQKKLKRVDQVPQKKDDSTCNSTVETRAQKARTECARKSRSEEIIDGTSEMNEGKRSQKTPSTPRRVTQGAAS
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged SP110 is approximately 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SP110 is approximately 0.3ng/ml as a capture antibody.)
Related Product Information for anti-SP110 antibody
The nuclear body is a multiprotein complex that may have a role in the regulation of gene transcription. This gene is a member of the SP100/SP140 family of nuclear body proteins and encodes a leukocyte-specific nuclear body component. The protein can function as an activator of gene transcription and may serve as a nuclear hormone receptor coactivator. In addition, it has been suggested that the protein may play a role in ribosome biogenesis and in the induction of myeloid cell differentiation. Alternative splicing has been observed for this gene and three transcript variants, encoding distinct isoforms, have been identified. [provided by RefSeq]
Product Categories/Family for anti-SP110 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
62,603 Da
NCBI Official Full Name
sp110 nuclear body protein isoform b
NCBI Official Synonym Full Names
SP110 nuclear body protein
NCBI Official Symbol
SP110
NCBI Official Synonym Symbols
IPR1; VODI; IFI41; IFI75
NCBI Protein Information
sp110 nuclear body protein; speckled 110 kDa; phosphoprotein 41; phosphoprotein 75; interferon-induced protein 41/75; transcriptional coactivator Sp110; interferon-induced protein 41, 30kD; interferon-induced protein 75, 52kD
UniProt Protein Name
Sp110 nuclear body protein
UniProt Gene Name
SP110
UniProt Entry Name
SP110_HUMAN

NCBI Description

The nuclear body is a multiprotein complex that may have a role in the regulation of gene transcription. This gene is a member of the SP100/SP140 family of nuclear body proteins and encodes a leukocyte-specific nuclear body component. The protein can function as an activator of gene transcription and may serve as a nuclear hormone receptor coactivator. In addition, it has been suggested that the protein may play a role in ribosome biogenesis and in the induction of myeloid cell differentiation. Alternative splicing has been observed for this gene and three transcript variants, encoding distinct isoforms, have been identified. [provided by RefSeq, Jul 2008]

Uniprot Description

SP110: Transcription factor. May be a nuclear hormone receptor coactivator. Enhances transcription of genes with retinoic acid response elements (RARE). Defects in SP110 are the cause of hepatic venoocclusive disease with immunodeficiency (VODI). VODI is an autosomal recessive primary immunodeficiency associated with hepatic vascular occlusion and fibrosis. The immunodeficiency is characterized by severe hypogammaglobulinemia, combined T and B cell immunodeficiency, absent lymph node germinal centers, and absent tissue plasma cells. 6 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: 2q37.1

Cellular Component: nucleolus; nucleus

Molecular Function: signal transducer activity; DNA binding; zinc ion binding; chromatin binding

Biological Process: chromatin remodeling; transcription, DNA-dependent; viral reproduction; regulation of transcription, DNA-dependent; signal transduction

Disease: Mycobacterium Tuberculosis, Susceptibility To; Hepatic Venoocclusive Disease With Immunodeficiency

Research Articles on SP110

Similar Products

Product Notes

The SP110 sp110 (Catalog #AAA6173089) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's SP110 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SP110 sp110 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SP110, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.