Mouse SOX8 Monoclonal Antibody | anti-SOX8 antibody

SOX8 (SRY (Sex Determining Region Y)-Box 8, MGC24837) (HRP)

Cat. Num. AAA6180721

• Applications: ELISA, Immunofluorescence, Western Blot
• Purity: Purified
• Synonyms: SOX8; Monoclonal Antibody; SOX8 (SRY (Sex Determining Region Y)-Box 8; MGC24837) (HRP); SRY (Sex Determining Region Y)-Box 8; MGC24837; anti-SOX8 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 8G7
• Specificity: Recognizes SOX8.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-SOX8 antibody: ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: SOX8 (NP_055402, 102aa-210aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: VKRPMNAFMVWAQAARRKLADQYPHLHNAELSKTLGKLWRLLSESEKRPFVEEAERLRVQHKKDHPDYKYQPRRRKSAKAGHSDSDSGAELGPHPGGGAVYKAEAGLGD
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to SOX8 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to SOX8 on HeLa cell. [antibody concentration 10 ug/ml])

Product Categories/Family for anti-SOX8 antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 30179903
• NCBI GeneID: 30812
• NCBI Accession #: NP_055402
• NCBI GenBank Nucleotide #: NM_014587
• UniProt Accession #: P57073
• Molecular Weight: 47kDa
• NCBI Official Full Name: transcription factor SOX-8
• NCBI Official Synonym Full Names: SRY-box 8
• NCBI Official Symbol: SOX8
• NCBI Protein Information: transcription factor SOX-8
• UniProt Protein Name: Transcription factor SOX-8
• Protein Family: Transcription factor
• UniProt Gene Name: SOX8
• UniProt Entry Name: SOX8_HUMAN

NCBI Description

This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional activator after forming a protein complex with other proteins. This protein may be involved in brain development and function. Haploinsufficiency for this protein may contribute to the cognitive disability found in an alpha-thalassemia-related syndrome (ART-16). This protein is also highly expressed in the majority of human hepatocellular carcinomas and promotes cellular proliferation and enhanced tumor growth. [provided by RefSeq, Jul 2017]

Uniprot Description

SOX8: May play a role in central nervous system, limb and facial development. May be involved in male sex determination. Binds the consensus motif 5'-[AT][AT]CAA[AT]G-3'.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: 16p13.3

Cellular Component: cytoplasm; nucleus

Molecular Function: DNA binding; protein heterodimerization activity; transcription factor binding

Biological Process: negative regulation of photoreceptor cell differentiation; transcription from RNA polymerase II promoter; fat cell differentiation; cell fate commitment; positive regulation of gliogenesis; in utero embryonic development; astrocyte fate commitment; positive regulation of transcription, DNA-dependent; male gonad development; cell maturation; signal transduction; Sertoli cell development; enteric nervous system development; peripheral nervous system development; osteoblast differentiation; retina development in camera-type eye; positive regulation of osteoblast proliferation; oligodendrocyte differentiation; spermatogenesis; positive regulation of transcription from RNA polymerase II promoter; negative regulation of transcription, DNA-dependent; negative regulation of myoblast differentiation; neural crest cell migration; negative regulation of apoptosis