Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (33.92kD).)

Mouse anti-Human SOX3 Monoclonal Antibody | anti-SOX3 antibody

SOX3 (Transcription Factor SOX-3) APC

Gene Names
SOX3; PHP; GHDX; MRGH; PHPX; SOXB
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SOX3; Monoclonal Antibody; SOX3 (Transcription Factor SOX-3) APC; anti-SOX3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1F2
Specificity
Recognizes human SOX3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-SOX3 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa375-446 from human SOX3 (NP_005625) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KSEPSSPPPAIASHSQRACLGDLRDMISMYLPPGGDAADAASPLPGGRLHGVHQHYQGAGTAVNGTVPLTH*
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (33.92kD).)

Western Blot (WB) (Western Blot detection against Immunogen (33.92kD).)

Western Blot (WB)

(SOX3 monoclonal antibody, Western Blot analysis of SOX3 expression in A-431.)

Western Blot (WB) (SOX3 monoclonal antibody, Western Blot analysis of SOX3 expression in A-431.)
Related Product Information for anti-SOX3 antibody
This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. Mutations in this gene have been associated with X-linked mental retardation with growth hormone deficiency.
Product Categories/Family for anti-SOX3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45kDa
NCBI Official Full Name
transcription factor SOX-3
NCBI Official Synonym Full Names
SRY-box 3
NCBI Official Symbol
SOX3
NCBI Official Synonym Symbols
PHP; GHDX; MRGH; PHPX; SOXB
NCBI Protein Information
transcription factor SOX-3
UniProt Protein Name
Transcription factor SOX-3
Protein Family
UniProt Gene Name
SOX3
UniProt Entry Name
SOX3_HUMAN

NCBI Description

This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. Mutations in this gene have been associated with X-linked cognitive disability with growth hormone deficiency. [provided by RefSeq, Jul 2008]

Uniprot Description

SOX3: Transcription factor required during the formation of the hypothalamo-pituitary axis. May function as a switch in neuronal development. Keeps neural cells undifferentiated by counteracting the activity of proneural proteins and suppresses neuronal differentiation. Required also within the pharyngeal epithelia for craniofacial morphogenesis. Controls a genetic switch in male development. Is necessary for initiating male sex determination by directing the development of supporting cell precursors (pre-Sertoli cells) as Sertoli rather than granulosa cells. Defects in SOX3 are a cause of panhypopituitarism X- linked (PHPX). Affected individuals have absent infundibulum, anterior pituitary hypoplasia, and ectopic posterior pituitary. Defects in SOX3 are the cause of mental retardation X- linked with isolated growth hormone deficiency (MRXGH). Defects in SOX3 are the cause of 46,XX sex reversal type 3 (SRXX3). A condition in which male gonads develop in a genetic female (female to male sex reversal). Copy number variations (CNV) encompassing or in close proximity to SOX3 are responsible for XX male reversal. These variations include two duplications of approximately 123 kb and 85 kb, the former of which spans the entire SOX3 gene; a 343 kb deletion immediately upstream of SOX3 that is probably responsible of altered regulation (and not increased dosage) of SOX3; a large (approximately 6 Mb) duplication that encompasses SOX3 and at least 18 additional distally located genes. Its proximal breakpoint falls within the SOX3 regulatory region. This large rearrangement has been found in a patient with XX male reversal and a complex phenotype that also includes a scrotal hypoplasia, microcephaly, developmental delay, and growth retardation.

Protein type: Nuclear receptor co-regulator; DNA-binding; Transcription factor

Chromosomal Location of Human Ortholog: Xq27.1

Cellular Component: nucleus

Molecular Function: DNA binding; transcription factor activity

Biological Process: sex determination; negative regulation of neuron differentiation; spermatid differentiation; hypothalamus development; organ morphogenesis; central nervous system development; sensory organ development; transcription, DNA-dependent; pituitary gland development; neuron development; negative regulation of transcription from RNA polymerase II promoter; Sertoli cell development

Disease: Panhypopituitarism, X-linked; Mental Retardation, X-linked, With Panhypopituitarism

Research Articles on SOX3

Similar Products

Product Notes

The SOX3 sox3 (Catalog #AAA6139238) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SOX3 (Transcription Factor SOX-3) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SOX3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SOX3 sox3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SOX3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.