Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (38.21kD).)

Mouse anti-Human PIK3R3 Monoclonal Antibody | anti-PIK3R3 antibody

PIK3R3 (Phosphatidylinositol 3-kinase Regulatory Subunit gamma, PI3-kinase Regulatory Subunit gamma, PI3K Regulatory Subunit gamma, PtdIns-3-kinase Regulatory Subunit gamma, Phosphatidylinositol 3-kinase 55kD Regulatory Subunit gamma, PI3-kinase Subunit p

Gene Names
PIK3R3; p55; p55-GAMMA
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PIK3R3; Monoclonal Antibody; PIK3R3 (Phosphatidylinositol 3-kinase Regulatory Subunit gamma; PI3-kinase Regulatory Subunit gamma; PI3K Regulatory Subunit gamma; PtdIns-3-kinase Regulatory Subunit gamma; Phosphatidylinositol 3-kinase 55kD Regulatory Subunit gamma; PI3-kinase Subunit p; anti-PIK3R3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2F8
Specificity
Recognizes human PIK3R3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-PIK3R3 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa271-381 from PIK3R3 (AAH21622) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
HDSKMRLEQDLKNQALDNREIDKKMNSIKPDLIQLRKIRDQHLVWLNHKGVRQKRLNVWLGIKNEDAAENYFINEEDENLPHYDEKTWFVEDINRVQAEDLLYGKPDGAF*
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.21kD).)

Western Blot (WB) (Western Blot detection against Immunogen (38.21kD).)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between EGFR and PIK3R3. HeLa cells were stained with EGFR rabbit purified polyclonal 1:1200 and PIK3R3 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between EGFR and PIK3R3. HeLa cells were stained with EGFR rabbit purified polyclonal 1:1200 and PIK3R3 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)
Related Product Information for anti-PIK3R3 antibody
Binds to activated (phosphorylated) protein-tyrosine kinases through its SH2 domain and regulates their kinase activity. During insulin stimulation, it also binds to IRS-1.
Product Categories/Family for anti-PIK3R3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
~61 kDa
NCBI Official Full Name
Homo sapiens phosphoinositide-3-kinase, regulatory subunit 3 (gamma), mRNA
NCBI Official Synonym Full Names
phosphoinositide-3-kinase, regulatory subunit 3 (gamma)
NCBI Official Symbol
PIK3R3
NCBI Official Synonym Symbols
p55; p55-GAMMA
NCBI Protein Information
phosphatidylinositol 3-kinase regulatory subunit gamma; p55PIK; PI3-kinase subunit p55-gamma; PI3K regulatory subunit gamma; 100% homology to SWISS-PROT Q92569; PI3-kinase regulatory subunit gamma; ptdIns-3-kinase regulatory subunit gamma; ptdIns-3-kinase
UniProt Protein Name
Phosphatidylinositol 3-kinase regulatory subunit gamma
UniProt Gene Name
PIK3R3
UniProt Synonym Gene Names
PI3-kinase regulatory subunit gamma; PI3K regulatory subunit gamma; PtdIns-3-kinase regulatory subunit gamma; PI3-kinase subunit p55-gamma; PtdIns-3-kinase regulatory subunit p55-gamma
UniProt Entry Name
P55G_HUMAN

Uniprot Description

PIK3R3: Binds to activated (phosphorylated) protein-tyrosine kinases through its SH2 domain and regulates their kinase activity. During insulin stimulation, it also binds to IRS-1. Heterodimer of a regulatory subunit PIK3R3 and a p110 catalytic subunit (PIK3CA, PIK3CB or PIK3CD). Interacts with AXL. Highest levels in brain and testis. Lower levels in adipose tissue, kidney, heart, lung and skeletal muscle. Belongs to the PI3K p85 subunit family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Motility/polarity/chemotaxis; Kinase, lipid

Chromosomal Location of Human Ortholog: 1p34.1

Cellular Component: cytosol; phosphoinositide 3-kinase complex

Molecular Function: protein binding; 1-phosphatidylinositol-3-kinase activity; phosphoinositide 3-kinase regulator activity

Biological Process: phospholipid metabolic process; phosphatidylinositol biosynthetic process; insulin receptor signaling pathway; regulation of phosphoinositide 3-kinase activity

Research Articles on PIK3R3

Similar Products

Product Notes

The PIK3R3 pik3r3 (Catalog #AAA6143565) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PIK3R3 (Phosphatidylinositol 3-kinase Regulatory Subunit gamma, PI3-kinase Regulatory Subunit gamma, PI3K Regulatory Subunit gamma, PtdIns-3-kinase Regulatory Subunit gamma, Phosphatidylinositol 3-kinase 55kD Regulatory Subunit gamma, PI3-kinase Subunit p reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PIK3R3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PIK3R3 pik3r3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PIK3R3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.