Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.89kD).)

Mouse anti-Human SOX10 Monoclonal Antibody | anti-SOX10 antibody

SOX10 (Transcription Factor SOX-10, MGC15649) (AP)

Gene Names
SOX10; DOM; WS4; PCWH; WS2E; WS4C
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SOX10; Monoclonal Antibody; SOX10 (Transcription Factor SOX-10; MGC15649) (AP); anti-SOX10 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1E6
Specificity
Recognizes human SOX10.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-SOX10 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 1.5ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa336-434 from human SOX10 (NP_008872) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KPPGVALPTVSPPGVDAKAQVKTETAGPQGPPHYTDQPSTSQIAYTSLSLPHYGSAFPSISRPQFDYSDHQPSGPYYGHSGQASGLYSAFSYMGPSQR*
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.89kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.89kD).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to SOX10 on formalin-fixed paraffin-embedded human colon. [antibody concentration 1.5ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to SOX10 on formalin-fixed paraffin-embedded human colon. [antibody concentration 1.5ug/ml].)
Product Categories/Family for anti-SOX10 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Predicted: 51 kDa
Observed: 54 kDa
NCBI Official Full Name
transcription factor SOX-10
NCBI Official Synonym Full Names
SRY-box 10
NCBI Official Symbol
SOX10
NCBI Official Synonym Symbols
DOM; WS4; PCWH; WS2E; WS4C
NCBI Protein Information
transcription factor SOX-10
UniProt Protein Name
Transcription factor SOX-10
Protein Family
UniProt Gene Name
SOX10

NCBI Description

This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional activator after forming a protein complex with other proteins. This protein acts as a nucleocytoplasmic shuttle protein and is important for neural crest and peripheral nervous system development. Mutations in this gene are associated with Waardenburg-Shah and Waardenburg-Hirschsprung disease. [provided by RefSeq, Jul 2008]

Uniprot Description

SOX10: Transcription factor that seems to function synergistically with the POU domain protein TST-1/OCT6/SCIP. Could confer cell specificity to the function of other transcription factors in developing and mature glia. Defects in SOX10 are the cause of Waardenburg syndrome type 2E (WS2E). WS2 is a genetically heterogeneous, autosomal dominant disorder characterized by sensorineural deafness, pigmentary disturbances, and absence of dystopia canthorum. The frequency of deafness is higher in WS2 than in WS1. Defects in SOX10 are a cause of Waardenburg syndrome type 4C (WS4C); also known as Waardenburg-Shah syndrome. WS4C is characterized by the association of Waardenburg features (depigmentation and deafness) and the absence of enteric ganglia in the distal part of the intestine (Hirschsprung disease). Defects in SOX10 are the cause of peripheral demyelinating neuropathy, central dysmyelinating leukodystrophy, Waardenburg syndrome, and Hirschsprung disease (PCWH); also called neurologic variant of Waardenburg-Shah syndrome. PCWH is a rare, complex and more severe neurocristopathy that includes features of 4 distinct syndromes: peripheral demyelinating neuropathy, central dysmyelinating leukodystrophy, Waardenburg syndrome, and Hirschsprung disease.

Protein type: Cell development/differentiation; DNA-binding; Transcription factor

Chromosomal Location of Human Ortholog: 22q13.1

Cellular Component: nucleoplasm; nucleus

Molecular Function: identical protein binding; protein binding; transcription coactivator activity

Biological Process: anatomical structure morphogenesis; regulation of transcription from RNA polymerase II promoter

Disease: Peripheral Demyelinating Neuropathy, Central Dysmyelination, Waardenburg Syndrome, And Hirschsprung Disease; Waardenburg Syndrome, Type 2e; Waardenburg Syndrome, Type 4c

Research Articles on SOX10

Similar Products

Product Notes

The SOX10 sox10 (Catalog #AAA6133929) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SOX10 (Transcription Factor SOX-10, MGC15649) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SOX10 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 1.5ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SOX10 sox10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SOX10, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.