Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between FGFR1 and SOS1 HeLa cells were stained with FGFR1 rabbit purified polyclonal 1:1200 and SOS1 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Mouse anti-Human SOS1 Monoclonal Antibody | anti-SOS1 antibody

SOS1 (Son of Sevenless Homolog 1, SOS-1) (PE)

Gene Names
SOS1; GF1; HGF; NS4; GGF1; GINGF; SOS-1
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SOS1; Monoclonal Antibody; SOS1 (Son of Sevenless Homolog 1; SOS-1) (PE); anti-SOS1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4C1
Specificity
Recognizes human SOS1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-SOS1 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa313-421 from human SOS1 (NP_005624) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SQLSKPGAALYLQSIGEGFKEAVQYVLPRLLLAPVYHCLHYFELLKQLEEKSEDQEDKECLKQAITALLNVQSGMEKICSKSLAKRRLSESACRFYSQQMKGKQLAIK*
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between FGFR1 and SOS1 HeLa cells were stained with FGFR1 rabbit purified polyclonal 1:1200 and SOS1 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between FGFR1 and SOS1 HeLa cells were stained with FGFR1 rabbit purified polyclonal 1:1200 and SOS1 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between CRKL and SOS1. Huh7 cells were stained with CRKL rabbit purified polyclonal 1:1200 and SOS1 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between CRKL and SOS1. Huh7 cells were stained with CRKL rabbit purified polyclonal 1:1200 and SOS1 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between GAB1 and SOS1. Mahlavu cells were stained with GAB1 rabbit purified polyclonal 1:1200 and SOS1 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between GAB1 and SOS1. Mahlavu cells were stained with GAB1 rabbit purified polyclonal 1:1200 and SOS1 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)
Product Categories/Family for anti-SOS1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
58.0kDa (495aa)
NCBI Official Full Name
son of sevenless homolog 1
NCBI Official Synonym Full Names
SOS Ras/Rac guanine nucleotide exchange factor 1
NCBI Official Symbol
SOS1
NCBI Official Synonym Symbols
GF1; HGF; NS4; GGF1; GINGF; SOS-1
NCBI Protein Information
son of sevenless homolog 1
UniProt Protein Name
Son of sevenless homolog 1
Protein Family
UniProt Gene Name
SOS1
UniProt Synonym Gene Names
SOS-1
UniProt Entry Name
SOS1_HUMAN

NCBI Description

This gene encodes a protein that is a guanine nucleotide exchange factor for RAS proteins, membrane proteins that bind guanine nucleotides and participate in signal transduction pathways. GTP binding activates and GTP hydrolysis inactivates RAS proteins. The product of this gene may regulate RAS proteins by facilitating the exchange of GTP for GDP. Mutations in this gene are associated with gingival fibromatosis 1 and Noonan syndrome type 4. [provided by RefSeq, Jul 2008]

Research Articles on SOS1

Similar Products

Product Notes

The SOS1 sos1 (Catalog #AAA6160443) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SOS1 (Son of Sevenless Homolog 1, SOS-1) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SOS1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SOS1 sos1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SOS1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.