Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human SOCS2 Monoclonal Antibody | anti-SOCS2 antibody

SOCS2 (Suppressor of Cytokine Signaling 2, SOCS-2, Cytokine-inducible SH2 Protein 2, CIS2, CIS-2, Cish2, STAT-induced STAT Inhibitor 2, SSI2, SSI-2, STATI2) (AP)

Gene Names
SOCS2; CIS2; SSI2; Cish2; SSI-2; SOCS-2; STATI2
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SOCS2; Monoclonal Antibody; SOCS2 (Suppressor of Cytokine Signaling 2; SOCS-2; Cytokine-inducible SH2 Protein 2; CIS2; CIS-2; Cish2; STAT-induced STAT Inhibitor 2; SSI2; SSI-2; STATI2) (AP); anti-SOCS2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3E7
Specificity
Recognizes human SOCS2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-SOCS2 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa99-198 from SOCS2 (AAH10399) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
YQDGKFRLDSIICVKSKLKQFDSVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTSAPSLQHLCRLTINKCTGAIWGLPLPTRLKDYLEEYKFQV
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Product Categories/Family for anti-SOCS2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
22,172 Da
NCBI Official Full Name
Homo sapiens suppressor of cytokine signaling 2, mRNA
NCBI Official Synonym Full Names
suppressor of cytokine signaling 2
NCBI Official Symbol
SOCS2
NCBI Official Synonym Symbols
CIS2; SSI2; Cish2; SSI-2; SOCS-2; STATI2
NCBI Protein Information
suppressor of cytokine signaling 2

NCBI Description

This gene encodes a member of the suppressor of cytokine signaling (SOCS) family. SOCS family members are cytokine-inducible negative regulators of cytokine receptor signaling via the Janus kinase/signal transducer and activation of transcription pathway (the JAK/STAT pathway). SOCS family proteins interact with major molecules of signaling complexes to block further signal transduction, in part, by proteasomal depletion of receptors or signal-transducing proteins via ubiquitination. The expression of this gene can be induced by a subset of cytokines, including erythropoietin, GM-CSF, IL10, interferon (IFN)-gamma and by cytokine receptors such as growth horomone receptor. The protein encoded by this gene interacts with the cytoplasmic domain of insulin-like growth factor-1 receptor (IGF1R) and is thought to be involved in the regulation of IGF1R mediated cell signaling. This gene has pseudogenes on chromosomes 20 and 22. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2012]

Research Articles on SOCS2

Similar Products

Product Notes

The SOCS2 (Catalog #AAA6133915) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SOCS2 (Suppressor of Cytokine Signaling 2, SOCS-2, Cytokine-inducible SH2 Protein 2, CIS2, CIS-2, Cish2, STAT-induced STAT Inhibitor 2, SSI2, SSI-2, STATI2) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SOCS2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SOCS2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SOCS2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.