Mouse anti-Human SNX11 Monoclonal Antibody | anti-SNX11 antibody

SNX11 (Sorting Nexin-11) (Biotin)

Cat. Num. AAA6144509

• Reactivity: Human
• Applications: ELISA, Immunoprecipitation, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: SNX11; Monoclonal Antibody; SNX11 (Sorting Nexin-11) (Biotin); MGC111019; anti-SNX11 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2G1
• Specificity: Recognizes human SNX11.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-SNX11 antibody: ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full-length recombinant corresponding to aa1-271 from human SNX11 (AAH00768) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MGFWCRMSENQEQEEVITVRVQDPRVQNEGSWNSYVDYKIFLHTNSKAFTAKTSCVRRRYREFVWLRKQLQRNAGLVPVPELPGKSTFFGTSDEFIEKRRQGLQHFLEKVLQSVVLLSDSQLHLFLQSQLSVPEIEACVQGRSTMTVSDAILRYAMSNCGWAQEERQSSSHLAKGDQPKSCCFLPRSGRRSSPSPPPSEEKDHLEVWAPVVDSEVPSLESPTLPPLSSPLCCDFGRPKEGTSTLQSVRRAVGGDH
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (55.81kD).)

Western Blot (WB)

(Western Blot analysis of SNX11 expression in transfected 293T cell line by SNX11 monoclonal antibody. Lane 1: SNX11 transfected lysate (30.4kD). Lane 2: Non-transfected lysate.)

Immunoprecipitation (IP)

(Immunoprecipitation of SNX11 transfected lysate using SNX11 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with SNX11 rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged SNX11 is 0.3ng/ml as a capture antibody.)

Product Categories/Family for anti-SNX11 antibody

Antibodies; SNX Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 33875835
• NCBI GeneID: 29916
• Molecular Weight: 29,423 Da
• NCBI Official Full Name: Homo sapiens sorting nexin 11, mRNA
• NCBI Official Synonym Full Names: sorting nexin 11
• NCBI Official Symbol: SNX11
• NCBI Protein Information: sorting nexin-11
• Protein Family: Sorting nexin

NCBI Description

This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein does not contain a coiled coil region, like some family members. This gene encodes a protein of unknown function. This gene results in two transcript variants differing in the 5' UTR, but encoding the same protein. [provided by RefSeq, Jul 2008]