Testing Data
(Detection limit for recombinant GST tagged SNRPB2 is 1ng/ml as a capture antibody.)
Mouse anti-Human SNRPB2 Monoclonal Antibody | anti-SNRPB2 antibody
SNRPB2 (U2 Small Nuclear Ribonucleoprotein B'', U2 snRNP B'', MGC24807, MGC45309) (Biotin)
Gene Names
SNRPB2; Msl1; U2B''
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SNRPB2; Monoclonal Antibody; SNRPB2 (U2 Small Nuclear Ribonucleoprotein B''; U2 snRNP B''; MGC24807; MGC45309) (Biotin); anti-SNRPB2 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2F4
Specificity
Recognizes human SNRPB2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
1005
Applicable Applications for anti-SNRPB2 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full-length recombinant corresponding to aa1-226 from human SNRPB2 (AAH36737) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MDIRPNHTIYINNMNDKIKKEELKRSLYALFSQFGHVVDIVALKTMKMRGQAFVIFKELGSSTNALRQLQGFPFYGKPMRIQYAKTDSDIISKMRGTFADKEKKKEKKKAKTVEQTATTTNKKPGQGTPNSANTQGNSTPNPQVPDYPPNYILFLNNLPEETNEMMLSMLFNQFPGFKEVRLVPGRHDIAFVEFENDGQAGAARDALQGFKITPSHAMKITYAKK*
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Testing Data
(Detection limit for recombinant GST tagged SNRPB2 is 1ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged SNRPB2 is 1ng/ml as a capture antibody.)
Related Product Information for anti-SNRPB2 antibody
The protein encoded by this gene associates with stem loop IV of U2 small nuclear ribonucleoprotein (U2 snRNP) in the presence of snRNP-A'. The encoded protein may play a role in pre-mRNA splicing. Autoantibodies from patients with systemic lupus erythematosus frequently recognize epitopes on the encoded protein. Two transcript variants encoding the same protein have been found for this gene.
Product Categories/Family for anti-SNRPB2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens small nuclear ribonucleoprotein polypeptide B'', mRNA
NCBI Official Synonym Full Names
small nuclear ribonucleoprotein polypeptide B2
NCBI Official Symbol
SNRPB2
NCBI Official Synonym Symbols
Msl1; U2B''
NCBI Protein Information
U2 small nuclear ribonucleoprotein B''
NCBI Description
The protein encoded by this gene associates with stem loop IV of U2 small nuclear ribonucleoprotein (U2 snRNP) in the presence of snRNP-A'. The encoded protein may play a role in pre-mRNA splicing. Autoantibodies from patients with systemic lupus erythematosus frequently recognize epitopes on the encoded protein. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]
Research Articles on SNRPB2
Similar Products
Product Notes
The SNRPB2 (Catalog #AAA6144503) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SNRPB2 (U2 Small Nuclear Ribonucleoprotein B'', U2 snRNP B'', MGC24807, MGC45309) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SNRPB2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SNRPB2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SNRPB2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
