Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (SNAI2 monoclonal antibody (M01), clone 6A7 Western Blot analysis of SNAI2 expression in Hela S3 NE (Cat # L013V3).)

Mouse SNAI2 Monoclonal Antibody | anti-SNAI2 antibody

SNAI2 (snail Homolog 2 (Drosophila), MGC10182, SLUG, SLUGH1, WS2D) (HRP)

Gene Names
SNAI2; SLUG; WS2D; SLUGH; SLUGH1; SNAIL2
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified
Synonyms
SNAI2; Monoclonal Antibody; SNAI2 (snail Homolog 2 (Drosophila); MGC10182; SLUG; SLUGH1; WS2D) (HRP); snail Homolog 2 (Drosophila); WS2D; anti-SNAI2 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
6A7
Specificity
Recognizes SNAI2.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-SNAI2 antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
SNAI2 (NP_003059, 97aa-169aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KDHSGSESPISDEEERLQSKLSDPHAIEAEKFQCNLCNKTYSTFSGLAKHKQLHCDAQSRKSFSCKYCDKEYV
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(SNAI2 monoclonal antibody (M01), clone 6A7 Western Blot analysis of SNAI2 expression in Hela S3 NE (Cat # L013V3).)

Western Blot (WB) (SNAI2 monoclonal antibody (M01), clone 6A7 Western Blot analysis of SNAI2 expression in Hela S3 NE (Cat # L013V3).)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to SNAI2 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to SNAI2 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to SNAI2 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to SNAI2 on HeLa cell. [antibody concentration 10 ug/ml])
Product Categories/Family for anti-SNAI2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32.4kDa (291aa)
NCBI Official Full Name
zinc finger protein SNAI2
NCBI Official Synonym Full Names
snail family transcriptional repressor 2
NCBI Official Symbol
SNAI2
NCBI Official Synonym Symbols
SLUG; WS2D; SLUGH; SLUGH1; SNAIL2
NCBI Protein Information
zinc finger protein SNAI2
UniProt Protein Name
Zinc finger protein SNAI2
Protein Family
UniProt Gene Name
SNAI2
UniProt Synonym Gene Names
SLUG; SLUGH
UniProt Entry Name
SNAI2_HUMAN

NCBI Description

This gene encodes a member of the Snail family of C2H2-type zinc finger transcription factors. The encoded protein acts as a transcriptional repressor that binds to E-box motifs and is also likely to repress E-cadherin transcription in breast carcinoma. This protein is involved in epithelial-mesenchymal transitions and has antiapoptotic activity. Mutations in this gene may be associated with sporatic cases of neural tube defects. [provided by RefSeq, Jul 2008]

Uniprot Description

Snail2: Transcriptional repressor. Involved in the generation and migration of neural crest cells. Plays a role in mediating RAF1-induced transcriptional repression of the TJ protein, occludin (OCLN) and subsequent oncogenic transformation of epithelial cells. Interacts (via SNAG domain) with LIMD1 (via LIM domains), WTIP (via LIM domains) and AJUBA (via LIM domains). Expressed in placenta and adult heart, pancreas, liver, kidney and skeletal muscle. Belongs to the snail C2H2-type zinc-finger protein family.

Protein type: C2H2-type zinc finger protein; Transcription factor; Apoptosis; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 8q11

Cellular Component: cytoplasm; nuclear chromatin; nucleus

Molecular Function: RNA polymerase II transcription factor activity, enhancer binding; sequence-specific DNA binding; metal ion binding; chromatin binding

Biological Process: transcription from RNA polymerase II promoter; substrate-bound cell migration, cell release from substrate; Notch signaling pathway; neural crest cell development; regulation of osteoblast differentiation; negative regulation of chondrocyte differentiation; palate development; negative regulation of transcription from RNA polymerase II promoter; Wnt receptor signaling pathway through beta-catenin; osteoblast differentiation; negative regulation of DNA damage response, signal transduction by p53 class mediator; sensory perception of sound; pigmentation; white fat cell differentiation; positive regulation of fat cell differentiation; epithelial to mesenchymal transition; positive regulation of histone acetylation; negative regulation of cell adhesion mediated by integrin; regulation of chemokine production; positive regulation of cell migration

Disease: Waardenburg Syndrome, Type 2d; Piebald Trait

Research Articles on SNAI2

Similar Products

Product Notes

The SNAI2 snai2 (Catalog #AAA6180880) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's SNAI2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SNAI2 snai2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SNAI2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.