Western Blot (WB)
(Western Blot detection against Immunogen (38.65kD).)
Mouse anti-Human SMAD9 Monoclonal Antibody | anti-SMAD9 antibody
SMAD9 (Mothers Against Decapentaplegic Homolog 9, MAD Homolog 9, Mothers Against DPP Homolog 9, Madh6, SMAD Family Member 9, SMAD 9, Smad9, MADH6, MADH9) (Biotin)
Gene Names
SMAD9; PPH2; MADH6; MADH9; SMAD8; SMAD8A; SMAD8B
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SMAD9; Monoclonal Antibody; SMAD9 (Mothers Against Decapentaplegic Homolog 9; MAD Homolog 9; Mothers Against DPP Homolog 9; Madh6; SMAD Family Member 9; SMAD 9; Smad9; MADH6; MADH9) (Biotin); anti-SMAD9 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3E5
Specificity
Recognizes human SMAD9.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-SMAD9 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa146-260 from human SMAD9 (NP_005896) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RHSEYNPQLSLLAKFRSASLHSEPLMPHNATYPDSFQQPPCSALPPSPSHAFSQSPCTASYPHSPGSPSEPESPYQHSDFRPVCYEEPQHWCSVAYYELNNRVGETFQASSRSVL
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (38.65kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (38.65kD).)
Related Product Information for anti-SMAD9 antibody
Smad9 is a member of the MAD-related family of molecules. MAD-related proteins are a recently identified family of intracellular proteins that are thought to be essential components in the signaling pathways of the serine/threonine kinase receptors of the transforming growth factor beta superfamily.
Product Categories/Family for anti-SMAD9 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
48,640 Da
NCBI Official Full Name
mothers against decapentaplegic homolog 9 isoform b
NCBI Official Synonym Full Names
SMAD family member 9
NCBI Official Symbol
SMAD9
NCBI Official Synonym Symbols
PPH2; MADH6; MADH9; SMAD8; SMAD8A; SMAD8B
NCBI Protein Information
mothers against decapentaplegic homolog 9; MAD homolog 9; Mothers against decapentaplegic, drosophila, homolog of, 9; SMAD, mothers against DPP homolog 9
UniProt Protein Name
Mothers against decapentaplegic homolog 9
Protein Family
UniProt Gene Name
SMAD9
UniProt Synonym Gene Names
MADH6; MADH9; MAD homolog 9; Mothers against DPP homolog 9; SMAD 9; Smad9
UniProt Entry Name
SMAD9_HUMAN
Similar Products
Product Notes
The SMAD9 smad9 (Catalog #AAA6144468) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SMAD9 (Mothers Against Decapentaplegic Homolog 9, MAD Homolog 9, Mothers Against DPP Homolog 9, Madh6, SMAD Family Member 9, SMAD 9, Smad9, MADH6, MADH9) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SMAD9 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SMAD9 smad9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SMAD9, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
