Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Immunoperoxidase of monoclonal antibody to SMAD2 on formalin-fixed paraffin-embedded human testis. [antibody concentration 5 ug/ml])

Mouse SMAD2 Monoclonal Antibody | anti-SMAD2 antibody

SMAD2 (SMAD Family Member 2, JV18, JV18-1, MADH2, MADR2, MGC22139, MGC34440, hMAD-2, hSMAD2) (HRP)

Gene Names
SMAD2; JV18; MADH2; MADR2; JV18-1; hMAD-2; hSMAD2
Applications
Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified
Synonyms
SMAD2; Monoclonal Antibody; SMAD2 (SMAD Family Member 2; JV18; JV18-1; MADH2; MADR2; MGC22139; MGC34440; hMAD-2; hSMAD2) (HRP); SMAD Family Member 2; hSMAD2; anti-SMAD2 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3G9
Specificity
Recognizes SMAD2.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Sequence Length
467
Applicable Applications for anti-SMAD2 antibody
Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
SMAD2 (AAH25699, 181aa-280aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PRHTEILTELPPLDDYTHSIPENTNFPAGIEPQSNYIPETPPPGYISEDGETSDQQLNQSMDTGSPAELSPTTLSPVNHSLDLQPVTYSEPAFWCSIAYY
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Immunoperoxidase of monoclonal antibody to SMAD2 on formalin-fixed paraffin-embedded human testis. [antibody concentration 5 ug/ml])

Testing Data (Immunoperoxidase of monoclonal antibody to SMAD2 on formalin-fixed paraffin-embedded human testis. [antibody concentration 5 ug/ml])

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to SMAD2 on formalin-fixed paraffin-embedded human testis. [antibody concentration 5 ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to SMAD2 on formalin-fixed paraffin-embedded human testis. [antibody concentration 5 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to SMAD2 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to SMAD2 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to SMAD2 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to SMAD2 on HeLa cell. [antibody concentration 10 ug/ml])

Western Blot (WB)

(SMAD2 monoclonal antibody (M05), clone 3G9 Western Blot analysis of SMAD2 expression in Hela S3 NE (Cat # L013V3).)

Western Blot (WB) (SMAD2 monoclonal antibody (M05), clone 3G9 Western Blot analysis of SMAD2 expression in Hela S3 NE (Cat # L013V3).)

Testing Data

(Detection limit for recombinant GST tagged SMAD2 is approximately 0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SMAD2 is approximately 0.1ng/ml as a capture antibody.)
Product Categories/Family for anti-SMAD2 antibody
References
1. Altered expression of p120catenin predicts poor outcome in invasive breast cancer. Talvinen K, Tuikkala J, Nykanen M, Nieminen A, Anttinen J, Nevalainen OS, Hurme S, Kuopio T, Kronqvist P.J Cancer Res Clin Oncol. 2010 Feb 12.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
SMAD family member 2
NCBI Official Synonym Full Names
SMAD family member 2
NCBI Official Symbol
SMAD2
NCBI Official Synonym Symbols
JV18; MADH2; MADR2; JV18-1; hMAD-2; hSMAD2
NCBI Protein Information
mothers against decapentaplegic homolog 2

NCBI Description

The protein encoded by this gene belongs to the SMAD, a family of proteins similar to the gene products of the Drosophila gene 'mothers against decapentaplegic' (Mad) and the C. elegans gene Sma. SMAD proteins are signal transducers and transcriptional modulators that mediate multiple signaling pathways. This protein mediates the signal of the transforming growth factor (TGF)-beta, and thus regulates multiple cellular processes, such as cell proliferation, apoptosis, and differentiation. This protein is recruited to the TGF-beta receptors through its interaction with the SMAD anchor for receptor activation (SARA) protein. In response to TGF-beta signal, this protein is phosphorylated by the TGF-beta receptors. The phosphorylation induces the dissociation of this protein with SARA and the association with the family member SMAD4. The association with SMAD4 is important for the translocation of this protein into the nucleus, where it binds to target promoters and forms a transcription repressor complex with other cofactors. This protein can also be phosphorylated by activin type 1 receptor kinase, and mediates the signal from the activin. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, May 2012]

Research Articles on SMAD2

Similar Products

Product Notes

The SMAD2 (Catalog #AAA6179285) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's SMAD2 can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SMAD2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SMAD2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.